JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158482

Recombinant Human IFI6 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human IFI6 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 130 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

G1P3, IFI6, Interferon alpha-inducible protein 6, Interferon-induced protein 6-16, Ifi-6-16

1 이미지
SDS-PAGE - Recombinant Human IFI6 protein (GST tag N-Terminus) (AB158482)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IFI6 protein (GST tag N-Terminus) (AB158482)

ab158482 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P09912","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

IFI6 also known as Interferon Alpha-Inducible Protein 6 is a 130-amino acid protein with a mass of approximately 14.7 kDa. This protein locates itself in the mitochondrial outer membrane and is expressed abundantly in tissues such as the liver muscle and kidney. The expression of IFI6 increases in response to interferon treatment especially interferons alpha and beta.
Biological function summary

IFI6 plays a role in apoptotic resistance mechanisms helping cells to avoid programmed death under stress conditions. This protein does not function as part of any large complex but operates independently to regulate apoptosis by controlling the mitochondrial membrane potential. Its involvement in cellular growth and immune response proves significant especially in viral infections where it modulates the cell's response to viral replication.

Pathways

IFI6 integrates into the interferon signaling pathway which is important in defending against viral infections. It collaborates with other proteins such as STAT2 and IRF9 to activate immune responses. Moreover IFI6 influences the apoptosis pathway where it interacts with anti-apoptotic proteins like Bcl-2 to support cell survival under certain conditions.

IFI6 is implicated mainly in viral infections and cancer. Its expression levels can affect viral persistence during infections such as hepatitis C. In cancer IFI6 has been observed in the context of melanoma where it interacts with proteins like Bcl-2 to potentially alter cancer cell survival and resistance to therapies. Understanding IFI6's role may hold importance for developing targeted treatments in such conditions.

일반 정보

기능

Interferon-stimulated protein that plays an important role in innate immune response against a wide variety of viruses (PubMed : 31142663). Inhibits flavivirus replication by preventing the formation of virus-induced endoplasmic reticulum membrane invaginations, which are double-membrane vesicles that flaviviruses use for their replication (PubMed : 30224801). Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, whose activation is required for entry of the virus into cells (PubMed : 25757571). Within the nucleus, restricts hepatitis B virus/HBV promoter activity leading to substantial reduction of viral replication and gene expression (PubMed : 33868257). Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis (PubMed : 15685448, PubMed : 17823654, PubMed : 26244642). However, it has also been shown to have a pro-apoptotic activity (PubMed : 27673746). Modulates innate immune response mediated by RIGI by preventing its activation (PubMed : 36793726).

서열 유사성

Belongs to the IFI6/IFI27 family.

Post-translational modifications

Glycosylated.

제품 프로토콜

타겟 정보

Interferon-stimulated protein that plays an important role in innate immune response against a wide variety of viruses (PubMed : 31142663). Inhibits flavivirus replication by preventing the formation of virus-induced endoplasmic reticulum membrane invaginations, which are double-membrane vesicles that flaviviruses use for their replication (PubMed : 30224801). Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, whose activation is required for entry of the virus into cells (PubMed : 25757571). Within the nucleus, restricts hepatitis B virus/HBV promoter activity leading to substantial reduction of viral replication and gene expression (PubMed : 33868257). Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis (PubMed : 15685448, PubMed : 17823654, PubMed : 26244642). However, it has also been shown to have a pro-apoptotic activity (PubMed : 27673746). Modulates innate immune response mediated by RIGI by preventing its activation (PubMed : 36793726).
See full target information IFI6

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com