JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259387

Recombinant human IL-1 beta protein (Active)

Recombinant human IL-1 beta 단백질 (Active)

5

(1 리뷰)

|

(2 제품이 사용된 논문 )

Recombinant human IL-1 beta protein (Active) is a Human Full Length protein, in the 117 to 269 aa range with >95% purity, ≤ 0.005 EU/µg endotoxin level and suitable for sELISA, SDS-PAGE, Functional studies, Cell Culture and more. The predicted molecular weight of ab259387 protein is 17.4 kDa.

- Save time and ensure accurate results - use our recombinant IL-1 beta protein as a control
- Tag-free, ensuring its native conformation
- Optimal protein bioactivity, stability and reproducibility
- Available in different sizes to fit your experimental needs

대체 명칭 보기

IL1F2, IL1B, Interleukin-1 beta, IL-1 beta, Catabolin

6 이미지
Sandwich ELISA - Recombinant human IL-1 beta protein (Active) (AB259387)
  • sELISA

Lab

Sandwich ELISA - Recombinant human IL-1 beta protein (Active) (AB259387)

Background subtracted standard curve using Human IL-1 beta Antibody Pair - BSA and Azide free (ab241807) and Recombinant human IL-1 beta protein (Active) (ab259387) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

Mass Spectrometry - Recombinant human IL-1 beta protein (Active) (AB259387)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant human IL-1 beta protein (Active) (AB259387)

M + 1.02 Da (calc mass 17433.98)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human IL-1 beta protein (Active) (AB259387)
  • FuncS

Lab

Functional Studies - Recombinant human IL-1 beta protein (Active) (AB259387)

Fully biologically active when compared to standard. ED50 is ≤ 0.7399 ng /ml, corresponding to a specific activity of 1.35 x 106 units/mg.

Sandwich ELISA - Recombinant human IL-1 beta protein (Active) (AB259387)
  • sELISA

Lab

Sandwich ELISA - Recombinant human IL-1 beta protein (Active) (AB259387)

Human IL-6 concentration was interpolated from the IL-6 standard curve. Supernatants from cell culture samples were serially diluted and assessed by the Human IL-6 ELISA kit (ab178013). Wild-type and IL-6 knockout A549 cells (ab273751) were assessed in duplicate (n=2). Cells were either treated with 20 ng/mL active recombinant human IL-1 beta protein (ab259387) for 24 h to induce expression of IL-6 or not treated with IL-1 beta. Data are represented as the mean and error bars represent standard deviation.

SDS-PAGE - Recombinant human IL-1 beta protein (Active) (AB259387)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human IL-1 beta protein (Active) (AB259387)

SDS-PAGE analysis of ab259387.

HPLC - Recombinant human IL-1 beta protein (Active) (AB259387)
  • HPLC

Lab

HPLC - Recombinant human IL-1 beta protein (Active) (AB259387)

Purity : 100%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, sELISA, Cell Culture, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. ED50 is ≤ 0.7399 ng /ml, corresponding to a specific activity of 1.35 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Ensure the validity of your result using our recombinant human IL-1 beta protein ab259387 as a control.

The ab259387 IL-1 beta protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC. Analyze your IL-1 beta ELISA data using the ab259387 protein to generate and plot a standard curve.

Check out our protein gel staining guide for SDS-PAGE here

Check out our ELISA protocol for more information here.

Premium Bioactive Protein range

The ab259387 IL-1 beta protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

서열 정보

[{"linker":null,"sequence":"APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS","proteinLength":"Full Length","predictedMolecularWeight":"17.43 kDa","actualMolecularWeight":null,"aminoAcidEnd":269,"aminoAcidStart":117,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01584","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

일반 정보

기능

Potent pro-inflammatory cytokine (PubMed : 10653850, PubMed : 12794819, PubMed : 28331908, PubMed : 3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production (PubMed : 3920526). Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells (PubMed : 10653850). Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 (PubMed : 12794819). Involved in transduction of inflammation downstream of pyroptosis : its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore (PubMed : 33377178, PubMed : 33883744). Acts as a sensor of S.pyogenes infection in skin : cleaved and activated by pyogenes SpeB protease, leading to an inflammatory response that prevents bacterial growth during invasive skin infection (PubMed : 28331908).

서열 유사성

Belongs to the IL-1 family.

Post-translational modifications

Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.. (Microbial infection) Cleavage by S.pyogenes cysteine protease SpeB promotes its activation independently of CASP1.

Subcellular localisation

Lysosome

제품 프로토콜

타겟 정보

Potent pro-inflammatory cytokine (PubMed : 10653850, PubMed : 12794819, PubMed : 28331908, PubMed : 3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production (PubMed : 3920526). Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells (PubMed : 10653850). Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 (PubMed : 12794819). Involved in transduction of inflammation downstream of pyroptosis : its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore (PubMed : 33377178, PubMed : 33883744). Acts as a sensor of S.pyogenes infection in skin : cleaved and activated by pyogenes SpeB protease, leading to an inflammatory response that prevents bacterial growth during invasive skin infection (PubMed : 28331908).
See full target information IL1B

제품이 사용된 논문 (2)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Biosensors 15: PubMed40136958

2025

Detecting Attomolar Concentrations of Interleukin IL-17A via Pollen-Based Nanoplasmonic Biochips.

Applications

Unspecified application

Species

Unspecified reactive species

Chiara Marzano,Rosalba Pitruzzella,Francesco Arcadio,Federica Passeggio,Mimimorena Seggio,Luigi Zeni,Laura Pasquardini,Nunzio Cennamo

International journal of rheumatic diseases 27:e15282 PubMed39091178

2024

IGJ depletion suppresses proliferation, inflammation, and motility of rheumatoid arthritis fibroblast-like synoviocytes via targeting NF-κB pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Jun Sheng,Fuyong Qiang,Qian He,Dan Xuan,Ruitao Liu
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com