JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259418

Recombinant human IL-12 p70 protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human IL-12 p70 protein (Active) is a Human Fragment protein, in the 23 to 219 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

대체 명칭 보기

NKSF2, IL12B, Interleukin-12 subunit beta, IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL-12 subunit p40, NK cell stimulatory factor chain 2, CLMF p40, NKSF1, IL12A, Interleukin-12 subunit alpha, IL-12A, Cytotoxic lymphocyte maturation factor 35 kDa subunit, IL-12 subunit p35, NK cell stimulatory factor chain 1, CLMF p35

5 이미지
Functional Studies - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • FuncS

Lab

Functional Studies - Recombinant human IL-12 p70 protein (Active) (AB259418)

Fully biologically active in a dose-dependent proliferation of NK-92 cell line. ED50 is ≤ 2.35 ng/ml, corresponding to a specific activity of 0.42 x 106 units/mg.

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)

M + 2.97 Da (Calc mass 34754.03 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-12 p70 protein (Active) (AB259418)

M + 2.8 Da (Calc. mass 22599.2 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

SDS-PAGE - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human IL-12 p70 protein (Active) (AB259418)

SDS-PAGE analysis of ab259418.

Protein is a heterodimer.

HPLC - Recombinant human IL-12 p70 protein (Active) (AB259418)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-12 p70 protein (Active) (AB259418)

Purity 96%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

< 0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, Cell Culture, Mass Spec, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active in a dose-dependent proliferation of NK-92 cell line. ED50 is ≤ 2.35 ng/ml, corresponding to a specific activity of 0.42 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

IL-12 p70 is a disulfide bonded heterodimer of the IL-12 40 kDa and 35 kDa subunits.

서열 정보

[{"linker":null,"sequence":"RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS","proteinLength":"Fragment","predictedMolecularWeight":"22.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":219,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P29460","tags":[]},{"linker":null,"sequence":"IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS","proteinLength":"Fragment","predictedMolecularWeight":"34.75 kDa","actualMolecularWeight":null,"aminoAcidEnd":328,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P29460","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

일반 정보

기능

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.. Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

서열 유사성

Belongs to the IL-12B family.

Post-translational modifications

Known to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified.

제품 프로토콜

타겟 정보

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.. Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
See full target information IL12B

Additional targets

IL12A

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com