JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB282392

Recombinant human IL-17A protein (Active)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant human IL-17A protein (Active) is a Human Full Length protein, in the 24 to 155 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.
5 이미지
Functional Studies - Recombinant human IL-17A protein (Active) (AB282392)
  • FuncS

Lab

Functional Studies - Recombinant human IL-17A protein (Active) (AB282392)

CXCL1 secretion in HT-29 cells following stimulation with IL-17A (Abcam, ab282392) in the presence of either an anti-IL-17RA antibody (ab325606) or an IgG isotype control (ab199376).

(A) Dose–response curve of HT-29 cells exposed to increasing concentrations of IL-17A.

(B) CXCL1 secretion induced by 100 ng/mL human IL-17A following treatment with anti-IL-17RA antibody (circles, solid line) or IgG isotype control (triangles, dotted line) across a range of concentrations. The IC₅₀ for inhibition of CXCL1 secretion is 0.25 µg/mL.

HT-29 cells were seeded at 1 × 10⁴ cells per well in a 96-well plate. Cells were pre-incubated with a dilution series of anti-IL-17RA antibody for 6 hours prior to IL-17A stimulation and then cultured for 48 hours in medium containing 10% FBS. CXCL1 levels were measured using a Human CXCL1 (GROα) ELISA kit (Abcam, ab190805).

Mass Spectrometry - Recombinant human IL-17A protein (Active) (AB282392)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human IL-17A protein (Active) (AB282392)

Mass determination by ESI-TOF.

Predicted MW is 15181.15 Da (+/- 10 Da by ESI-TOF). Observed MW is 15182.44 Da.

Functional Studies - Recombinant human IL-17A protein (Active) (AB282392)
  • FuncS

Supplier Data

Functional Studies - Recombinant human IL-17A protein (Active) (AB282392)

Functional analysis of ab282392.

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED50 is ≤ 7.5 ng/mL, corresponding to a specific activity of 1.33 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3400366-2

HPLC - Recombinant human IL-17A protein (Active) (AB282392)
  • HPLC

Supplier Data

HPLC - Recombinant human IL-17A protein (Active) (AB282392)

HPLC analysis of ab282392.

SDS-PAGE - Recombinant human IL-17A protein (Active) (AB282392)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human IL-17A protein (Active) (AB282392)

SDS-PAGE analysis of ab282392.

주요 정보

Purity

>95% HPLC

=95% Purity determined by HPLC and SDS-PAGE

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED<sub>50</sub> is &le; 7.5 ng/mL, corresponding to a specific activity of 1.33 x 10<sup>5</sup> units/mg.

Accession

Q16552-1

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA","proteinLength":"Full Length","predictedMolecularWeight":"15.18 kDa","actualMolecularWeight":null,"aminoAcidEnd":155,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q16552","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

제품 프로토콜

타겟 정보

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 17911633, PubMed : 18684971, PubMed : 19825828, PubMed : 21350122, PubMed : 24120361, PubMed : 8676080). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (By similarity). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (By similarity). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (By similarity). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (By similarity). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (By similarity). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection (PubMed : 21350122). Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (By similarity). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (By similarity). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (By similarity). Involved in antiviral host defense through various mechanisms (By similarity). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (By similarity). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (By similarity). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (By similarity).
See full target information IL17A

대체 명칭 보기

CTLA8, IL17, IL17A, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Biosensors 15: PubMed40136958

2025

Detecting Attomolar Concentrations of Interleukin IL-17A via Pollen-Based Nanoplasmonic Biochips.

Applications

Unspecified application

Species

Unspecified reactive species

Chiara Marzano,Rosalba Pitruzzella,Francesco Arcadio,Federica Passeggio,Mimimorena Seggio,Luigi Zeni,Laura Pasquardini,Nunzio Cennamo
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com