JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281811

Recombinant Human IL-33 protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human IL-33 protein (Active) is a Human Full Length protein, in the 95 to 270 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC, FuncS, Cell Culture.

대체 명칭 보기

C9orf26, IL1F11, NFHEV, IL33, Interleukin-33, IL-33, Interleukin-1 family member 11, Nuclear factor from high endothelial venules, IL-1F11, NF-HEV

5 이미지
Functional Studies - Recombinant Human IL-33 protein (Active) (AB281811)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human IL-33 protein (Active) (AB281811)

Recombinant Human IL-33 protein was determined to be fully biologically active by the dose dependent proliferation of D10S cells. ED50 is ≤ 1.70 ng/ml, corresponding to a specific activity of 5.9 x 10⁵ units/mg.

Cell based assay testing is performed on the first lot of the protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3425563-1.

Mass Spectrometry - Recombinant Human IL-33 protein (Active) (AB281811)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human IL-33 protein (Active) (AB281811)

ESI-TOF analysis of ab281811.

Predicted MW is 19883.29 Da (+/- 10 Da by ESI-TOF). Observed MW is 19884.54 Da.

Biochemical assay - Recombinant Human IL-33 protein (Active) (AB281811)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human IL-33 protein (Active) (AB281811)

Fully biologically active determined by the dose dependent proliferation of D10S cells. ED50 <= 1.70 ng/ml, corresponding to a specific activity of 5.9x105 units/mg.

SDS-PAGE - Recombinant Human IL-33 protein (Active) (AB281811)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IL-33 protein (Active) (AB281811)

SDS-PAGE analysis of ab281811.

HPLC - Recombinant Human IL-33 protein (Active) (AB281811)
  • HPLC

Supplier Data

HPLC - Recombinant Human IL-33 protein (Active) (AB281811)

HPLC analysis of ab281811.

주요 정보

Purity

>95% SDS-PAGE

Purity >=95% by HPLC.

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of D10S cells. ED50 is ≤ 1.70 ng/ml, corresponding to a specific activity of 5.9 x 105 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"AFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET","proteinLength":"Full Length","predictedMolecularWeight":"19.88 kDa","actualMolecularWeight":"19.89 kDa","aminoAcidEnd":270,"aminoAcidStart":95,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O95760","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

일반 정보

기능

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 16286016, PubMed : 19841166). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (PubMed : 17853410, PubMed : 18836528). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (PubMed : 17853410, PubMed : 18836528). Acts as an enhancer of polarization of alternatively activated macrophages (PubMed : 19841166). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (PubMed : 17853410, PubMed : 18836528). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed : 21734074). This form is rapidely lost upon angiogenic or pro-inflammatory activation (PubMed : 18787100).

서열 유사성

Belongs to the IL-1 family. Highly divergent.

Post-translational modifications

The full-length protein can be released from cells and is able to signal via the IL1RL1/ST2 receptor. However, proteolytic processing by CELA1, CSTG/cathepsin G and ELANE/neutrophil elastase produces C-terminal peptides that are more active than the unprocessed full length protein (PubMed:22307629, PubMed:35794369). May also be proteolytically processed by calpains (PubMed:19596270, PubMed:22307629). Proteolytic cleavage mediated by apoptotic caspases including CASP3 and CASP7 results in IL33 inactivation (PubMed:19559631). In vitro proteolytic cleavage by CASP1 was reported (PubMed:16286016, PubMed:19439663) but could not be confirmed in vivo (PubMed:19465481) suggesting that IL33 is probably not a direct substrate for that caspase (PubMed:19439663, PubMed:19465481).

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 16286016, PubMed : 19841166). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (PubMed : 17853410, PubMed : 18836528). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (PubMed : 17853410, PubMed : 18836528). Acts as an enhancer of polarization of alternatively activated macrophages (PubMed : 19841166). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (PubMed : 17853410, PubMed : 18836528). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed : 21734074). This form is rapidely lost upon angiogenic or pro-inflammatory activation (PubMed : 18787100).
See full target information IL33

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com