JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB135223

Recombinant Human INCENP protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human INCENP protein (His tag N-Terminus) is a Human Fragment protein, in the 783 to 918 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, WB, FuncS.
1 이미지
SDS-PAGE - Recombinant Human INCENP protein (His tag N-Terminus) (AB135223)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human INCENP protein (His tag N-Terminus) (AB135223)

SDS-PAGE analysis of ab135223.

주요 정보

Purity

>90% SDS-PAGE

Affinity purified.

발현 시스템

Baculovirus infected Sf9 cells

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE, FuncS

applications

Biologically active

No

Accession

Q9NQS7-1

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.75% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab135223 can be used for Aurora B and Aurora C activation<i> in vitro</i>.</p>" } } }

서열 정보

[{"linker":null,"sequence":"AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH","proteinLength":"Fragment","predictedMolecularWeight":"19 kDa","actualMolecularWeight":null,"aminoAcidEnd":918,"aminoAcidStart":783,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q9NQS7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

INCENP short for Inner Centromere Protein plays a mechanical role during cell division. It acts as an important component of the chromosomal passenger complex (CPC) an important player in mitosis. INCENP is approximately 95 kDa in mass and is expressed largely in dividing cells. It helps to regulate chromosome alignment segregation and cytokinesis by interacting with other CPC members. Its activity is centered on the centromeres and the spindle midzone making it essential for proper mitotic progression.
Biological function summary

INCENP functions within the CPC which includes the kinase Aurora B Survivin and Borealin. This complex facilitates proper chromosomal alignment and segregation during mitosis. INCENP links Aurora B kinase activity to the centromere essential for correct chromosome bi-orientation and tension sensing. As a result INCENP stabilizes the architecture of the mitotic spindle ensuring successful cell cycle completion. This process is vital for maintaining genomic stability in proliferating cells.

Pathways

INCENP participates in the signaling cascades that control mitosis and cellular division. It is involved in the spindle assembly checkpoint pathway ensuring that cells do not progress through mitosis with misaligned chromosomes. INCENP interacts closely with proteins such as Aurora B and Survivin within this checkpoint mechanism. These interactions ensure that the cell cycle does not proceed until all chromosomes are correctly attached to the spindle apparatus thereby safeguarding against aneuploidy.

INCENP has strong connections to cancer and various chromosomal instability syndromes. Misregulation or mutation of INCENP can lead to an improper chromosomal segregation resulting in aneuploidy a hallmark of many cancer types. Its association with Aurora B and the other CPC components further implicates its role in tumorigenesis. Alterations in INCENP function could also contribute to disorders characterized by genomic instability highlighting its importance in cell division and genomic integrity.

일반 정보

기능

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Acts as a scaffold regulating CPC localization and activity. The C-terminus associates with AURKB or AURKC, the N-terminus associated with BIRC5/survivin and CDCA8/borealin tethers the CPC to the inner centromere, and the microtubule binding activity within the central SAH domain directs AURKB/C toward substrates near microtubules (PubMed : 12925766, PubMed : 15316025, PubMed : 27332895). The flexibility of the SAH domain is proposed to allow AURKB/C to follow substrates on dynamic microtubules while ensuring CPC docking to static chromatin (By similarity). Activates AURKB and AURKC (PubMed : 27332895). Required for localization of CBX5 to mitotic centromeres (PubMed : 21346195). Controls the kinetochore localization of BUB1 (PubMed : 16760428).

서열 유사성

Belongs to the INCENP family.

Post-translational modifications

Phosphorylation by AURKB or AURKC at its C-terminal part is important for AURKB or AURKC activation by INCENP.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Acts as a scaffold regulating CPC localization and activity. The C-terminus associates with AURKB or AURKC, the N-terminus associated with BIRC5/survivin and CDCA8/borealin tethers the CPC to the inner centromere, and the microtubule binding activity within the central SAH domain directs AURKB/C toward substrates near microtubules (PubMed : 12925766, PubMed : 15316025, PubMed : 27332895). The flexibility of the SAH domain is proposed to allow AURKB/C to follow substrates on dynamic microtubules while ensuring CPC docking to static chromatin (By similarity). Activates AURKB and AURKC (PubMed : 27332895). Required for localization of CBX5 to mitotic centromeres (PubMed : 21346195). Controls the kinetochore localization of BUB1 (PubMed : 16760428).
See full target information INCENP

대체 명칭 보기

Inner centromere protein, INCENP

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com