JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158773

Recombinant Human Integrin alpha 4/CD49D protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Integrin alpha 4/CD49D protein (GST tag N-Terminus) is a Human Fragment protein, in the 98 to 207 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

CD49d, CD49D, ITGA4, Integrin alpha-4, CD49 antigen-like family member D, Integrin alpha-IV, VLA-4 subunit alpha

1 이미지
SDS-PAGE - Recombinant Human Integrin alpha 4/CD49D protein (GST tag N-Terminus) (AB158773)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Integrin alpha 4/CD49D protein (GST tag N-Terminus) (AB158773)

ab158773 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as Integrin alpha 4.

서열 정보

[{"linker":null,"sequence":"RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":207,"aminoAcidStart":98,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P13612","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Integrin alpha 4 also known as CD49D or ITGA4 is a transmembrane receptor with a mass of approximately 150 kDa. This protein is expressed on the surface of leukocytes including T and B lymphocytes monocytes and eosinophils. Integrin alpha 4 functions by interacting mechanically with the extracellular matrix components and endothelial cell counter-receptors like VCAM-1 facilitating cell adhesion and migration. Its expression is vital for the immune cells' ability to move and locate sites of inflammation or injury.
Biological function summary

Integrin alpha 4 forms a heterodimer complex with beta subunits like beta 1 (forming VLA-4) or beta 7 allowing it to mediate adhesion and signaling pathways. In particular the alpha 4 and beta 1 dimerization gives rise to a high-affinity receptor for fibronectin and VCAM-1. This interaction is essential for regulating immune responses and maintaining cell positioning within tissues. The presence of this complex on leukocytes drives their ability to navigate through the vasculature to inflamed areas.

Pathways

Integrin alpha 4 participates in significant signal transduction pathways including the MAPK and PI3K-Akt pathways. These pathways modulate cell survival proliferation and migration. In the MAPK pathway integrin alpha 4 influences cell signaling cascades by interacting with other proteins like TALIN or PAXILLIN which are important for integrin-mediated signal relay. In connection with PI3K-Akt pathway alpha 4 integrins work closely with proteins in regulating cellular adhesion and motility showing a dynamic interplay in immune regulation.

Integrin alpha 4 plays an important role in various immune-related diseases such as multiple sclerosis and Crohn's disease. The protein's participation in leukocyte adhesion and trafficking makes it a target for therapeutic intervention. Natalizumab a monoclonal antibody against alpha 4 integrin showcases the critical link between the protein and disease treatment by blocking leukocyte migration to reduce inflammation. Additionally integrin alpha 4's interaction with proteins like VCAM-1 and VLA-4 highlights its relevance in these autoimmune conditions highlighting its importance in disease pathophysiology.

일반 정보

기능

Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4 : ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed : 23125415). ITGA4 : ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed : 18635536, PubMed : 25398877). Integrin ITGA4 : ITGB1 represses PRKCA-mediated L-type voltage-gated channel Ca(2+) influx and ROCK-mediated calcium sensitivity in vascular smooth muscle cells via its interaction with SVEP1, thereby inhibiting vasocontraction (PubMed : 35802072).

서열 유사성

Belongs to the integrin alpha chain family.

Post-translational modifications

Phosphorylation on Ser-1027 inhibits PXN binding.

제품 프로토콜

타겟 정보

Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4 : ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed : 23125415). ITGA4 : ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed : 18635536, PubMed : 25398877). Integrin ITGA4 : ITGB1 represses PRKCA-mediated L-type voltage-gated channel Ca(2+) influx and ROCK-mediated calcium sensitivity in vascular smooth muscle cells via its interaction with SVEP1, thereby inhibiting vasocontraction (PubMed : 35802072).
See full target information ITGA4

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com