JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114551

Recombinant Human ITGA7 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human ITGA7 protein (GST tag N-Terminus) is a Human Fragment protein, in the 478 to 577 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

UNQ406/PRO768, ITGA7, Integrin alpha-7

1 이미지
SDS-PAGE - Recombinant Human ITGA7 protein (GST tag N-Terminus) (AB114551)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ITGA7 protein (GST tag N-Terminus) (AB114551)

12.5% SDS-PAGE Stained with Coomassie Blue showing ab114551.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":577,"aminoAcidStart":478,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13683","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

ITGA7 also known as integrin alpha 7 is a transmembrane protein that plays an important role in cell adhesion and signaling. Weighing approximately 124 kDa ITGA7 is part of the integrin family of proteins functioning as a receptor that binds primarily to extracellular matrix proteins such as laminins. It is expressed largely in skeletal and cardiac muscle tissues but research shows its presence in other tissues like the nervous system.
Biological function summary

ITGA7 interacts with the beta-1 integrin subunit to form a heterodimeric receptor. This combination mediates cell-matrix adhesion promoting cell migration differentiation and survival. ITGA7 is also involved in the stabilization of mature muscle cells and development of muscle fibers. By engaging with specific laminin isoforms ITGA7 influences tissue architecture and function.

Pathways

Researchers recognize that ITGA7 is important in signaling pathways like the PI3K/Akt pathway which affects cell growth and survival. ITGA7 interacts with proteins like focal adhesion kinase (FAK) to transmit signals from the extracellular matrix to the inside of the cell. This communication helps regulate cellular responses and adaptability in dynamic environments.

ITGA7 has connections to muscular dystrophy and certain types of cancer. Mutations or altered expression of ITGA7 can lead to muscular dystrophy where muscle function becomes compromised. In cancer altered ITGA7 expression may affect tumor progression and metastasis with connections to proteins such as dystroglycan. Understanding these relationships is essential for developing targeted therapeutic interventions.

일반 정보

기능

Integrin alpha-7/beta-1 is the primary laminin receptor on skeletal myoblasts and adult myofibers. During myogenic differentiation, it may induce changes in the shape and mobility of myoblasts, and facilitate their localization at laminin-rich sites of secondary fiber formation. It is involved in the maintenance of the myofibers cytoarchitecture as well as for their anchorage, viability and functional integrity. Isoform Alpha-7X2B and isoform Alpha-7X1B promote myoblast migration on laminin 1 and laminin 2/4, but isoform Alpha-7X1B is less active on laminin 1 (In vitro). Acts as a Schwann cell receptor for laminin-2. Acts as a receptor of COMP and mediates its effect on vascular smooth muscle cells (VSMCs) maturation (By similarity). Required to promote contractile phenotype acquisition in differentiated airway smooth muscle (ASM) cells.

서열 유사성

Belongs to the integrin alpha chain family.

Post-translational modifications

ADP-ribosylated on at least two sites of the extracellular domain in skeletal myotubes.. A 70 kDa form is created by proteolytic cleavage. Cleavage is elevated during myogenic differentiation and the cleaved form enhances cell adhesion and spreading on laminin.

제품 프로토콜

타겟 정보

Integrin alpha-7/beta-1 is the primary laminin receptor on skeletal myoblasts and adult myofibers. During myogenic differentiation, it may induce changes in the shape and mobility of myoblasts, and facilitate their localization at laminin-rich sites of secondary fiber formation. It is involved in the maintenance of the myofibers cytoarchitecture as well as for their anchorage, viability and functional integrity. Isoform Alpha-7X2B and isoform Alpha-7X1B promote myoblast migration on laminin 1 and laminin 2/4, but isoform Alpha-7X1B is less active on laminin 1 (In vitro). Acts as a Schwann cell receptor for laminin-2. Acts as a receptor of COMP and mediates its effect on vascular smooth muscle cells (VSMCs) maturation (By similarity). Required to promote contractile phenotype acquisition in differentiated airway smooth muscle (ASM) cells.
See full target information ITGA7

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com