JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132771

Recombinant Human KAR protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human KAR protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 98 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

SDR12C1, HSD17B12, Very-long-chain 3-oxoacyl-CoA reductase, 17-beta-hydroxysteroid dehydrogenase 12, 3-ketoacyl-CoA reductase, Estradiol 17-beta-dehydrogenase 12, Short chain dehydrogenase/reductase family 12C member 1, 17-beta-HSD 12, KAR

1 이미지
SDS-PAGE - Recombinant Human KAR protein (GST tag N-Terminus) (AB132771)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human KAR protein (GST tag N-Terminus) (AB132771)

12.5% SDS-PAGE analysis of ab132771 stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as HSD17B12.

서열 정보

[{"linker":null,"sequence":"MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT","proteinLength":"Full Length","predictedMolecularWeight":"36.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":98,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q53GQ0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Kainate receptors (KARs) are ionotropic receptors important for fast excitatory neurotransmission. They are also known as 'kainate-type glutamate receptors' and are part of the larger glutamate receptor family. The typical mass of these receptors can vary due to different subunits but they usually range between 100 and 120 kDa. KARs express in the central nervous system especially in regions such as the hippocampus and cortex. They involve in synaptic transmission and plasticity through their role as ligand-gated ion channels.
Biological function summary

KARs participate in mediating excitatory synaptic transmission and are part of a complex with other ion channels and receptors like AMPA and NMDA receptors. They regulate synaptic strength and plasticity which are important for learning and memory processes. Active in both pre- and postsynaptic sites KARs can either enhance or inhibit neurotransmitter release affecting neuronal excitability. Their ability to modulate other neurotransmitter systems highlights their diverse influence on neural circuits.

Pathways

KARs are critical components in the glutamatergic signaling pathway which includes AMPA and NMDA receptors as well. They work closely with these proteins to regulate synaptic plasticity and excitatory neurotransmission. Investigations show the involvement of KARs in the long-term potentiation pathway important for memory encoding. Additionally they overlap with metabotropic glutamate receptors influencing intracellular signaling cascades and calcium dynamics.

KARs have associations with epilepsy and neurodegenerative diseases like Alzheimer’s disease. Dysfunctional KAR signaling can lead to altered neuronal excitability contributing to epilepsy pathogenesis. Moreover in Alzheimer's altered glutamatergic transmission due to impaired KAR function associates with memory deficits. Their connection with AMPA and NMDA receptors is significant here as these proteins also pertain to synaptic dysfunction and cognitive impairments observed in these conditions.

일반 정보

기능

Catalyzes the second of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme has a 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA, within each cycle of fatty acid elongation. Thereby, it may participate in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May also catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation.

서열 유사성

Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

제품 프로토콜

타겟 정보

Catalyzes the second of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme has a 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA, within each cycle of fatty acid elongation. Thereby, it may participate in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May also catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation.
See full target information HSD17B12

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com