JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB309960

Recombinant human KRAS Protein (His-tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human KRAS Protein (His-tag) is a Human Full Length protein, in the 1 to 186 aa range, expressed in Escherichia coli, with >95%, <0.1 EU/mg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE.

대체 명칭 보기

KRAS2, RASK2, KRAS, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras

2 이미지
Mass Spectrometry - Recombinant human KRAS Protein (His-tag) (AB309960)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant human KRAS Protein (His-tag) (AB309960)

Mass determination by ESI-TOF. Predicted MW is 23461.86 (+/- 10Da by ESI-TOF). Observed MW is 23330.75.

SDS-PAGE - Recombinant human KRAS Protein (His-tag) (AB309960)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human KRAS Protein (His-tag) (AB309960)

SDS-PAGE analysis of ab309960

주요 정보

Purity

>95% HPLC

SDS-PAGE >= 95%

Endotoxin 레벨

<0.1 EU/mg

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

No

Species

Human

보관 버퍼

pH: 7 Constituents: 20% Glycerol (glycerin, glycerine), 1.4586% Sodium chloride, 0.2681% Disodium hydrogenorthophosphate, 0.172% Sodium Phosphate Monobasic, 0.0148% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC","proteinLength":"Full Length","predictedMolecularWeight":"23.5 kDa","actualMolecularWeight":"23.3 kDa","aminoAcidEnd":186,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01116","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The KRAS protein also known as Kirsten rat sarcoma viral oncogene homolog is a small GTPase weighing around 21 kDa. It plays an important role in cell signaling pathways and is widely expressed in various tissues. As a molecular switch KRAS cycles between an active GTP-bound state and an inactive GDP-bound state regulating cell proliferation differentiation and survival. KRAS mutations are often studied using various cell lines including the HCT116 line which is a human colorectal carcinoma cell line with a KRAS mutant background. Western blot analysis commonly helps in investigating KRAS protein expression and activity levels.
Biological function summary

KRAS influences many cellular processes. It is not part of a complex but acts alone within its pathways. It modulates signal transduction processes which are significant for the control of proliferation apoptosis and cell cycle progress. Mutations within this protein such as KRAS G12V and KRAS G12D lead to continuous activation and can cause uncontrolled cell growth which links them to various cancers. KRAS commonly interacts with proteins like RAF kinase and PI3K signaling components to execute its functions.

Pathways

KRAS is an important component in at least two important signaling pathways: the MAPK/ERK pathway and the PI3K/AKT pathway. These pathways play major roles in regulating gene expression that drives cell growth and division. In the MAPK/ERK pathway KRAS activates RAF which subsequently initiates a phosphorylation cascade that stimulates ERK. This protein also interacts with elements of the PI3K/AKT pathway influencing cellular survival and metabolism. These interactions position KRAS as a vital oncogene in cancer biology.

KRAS mutations are important in the development and progression of colorectal and pancreatic cancers. The persistence of active KRAS leads to continuous signaling that drives tumor growth and resistance to apoptosis. KRAS-associated cancers often show poor prognosis partly due to limited therapeutic options. Its interaction with proteins like EGFR (Epidermal Growth Factor Receptor) in various cancers highlights complex treatment challenges as these proteins can provide alternative signaling routes further complicating disease management.

일반 정보

기능

Signal transducer in the Ras-MAPK signaling pathway that regulates cell proliferation and survival (PubMed : 22711838, PubMed : 23698361). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed : 20949621, PubMed : 39809765). Activates MAPK1/MAPK3 resulting in phosphorylation and ultimately degradation of GJA1 (By similarity). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed : 24623306). Recognized by LZTR1 that mediates its ubiquitination by a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex (PubMed : 40934300).

서열 유사성

Belongs to the small GTPase superfamily. Ras family.

Post-translational modifications

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).. Palmitoylated at Lys-182, Lys-184 and Lys-185 (PubMed:29239724). Palmitoylation on lysine residues is promoted by palmitoylation at Cys-180 (PubMed:29239724). Lysine-depalmitoylation by SIRT2 promotes its localization to endomembranes in endocytic pathways (PubMed:29239724).. Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.. (Microbial infection) Glucosylated at Thr-35 by P.sordellii toxin TcsL.

제품 프로토콜

타겟 정보

Signal transducer in the Ras-MAPK signaling pathway that regulates cell proliferation and survival (PubMed : 22711838, PubMed : 23698361). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed : 20949621, PubMed : 39809765). Activates MAPK1/MAPK3 resulting in phosphorylation and ultimately degradation of GJA1 (By similarity). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed : 24623306). Recognized by LZTR1 that mediates its ubiquitination by a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex (PubMed : 40934300).
See full target information KRAS

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com