JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB322317

Recombinant Human LAG-3 protein (Fc Chimera)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human LAG-3 protein (Fc Chimera) is a Human Fragment protein, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for Mass Spec, HPLC, SDS-PAGE.
1 이미지
SDS-PAGE - Recombinant Human LAG-3 protein (Fc Chimera) (AB322317)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LAG-3 protein (Fc Chimera) (AB322317)

SDS-PAGE analysis of ab322317 under reducing conditions for 2ug protein.

주요 정보

Purity

>95% HPLC

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE, Mass Spec, HPLC

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

P18627-1

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL","proteinLength":"Fragment","predictedMolecularWeight":"72.13 kDa","actualMolecularWeight":"72.01 kDa","aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P18627","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

LAG-3 also known as CD223 is a transmembrane protein with a mass of approximately 70 kDa. It acts as a checkpoint molecule similar to CTLA-4 and PD-1 in the immune system. LAG-3 is expressed on activated T cells natural killer cells and some dendritic cells. It interacts with its ligand MHC class II leading to inhibition of cellular proliferation and cytokine secretion an important part of immune response regulation.
Biological function summary

LAG-3 is involved in maintaining immune homeostasis and preventing autoimmunity. It is not part of a complex but works in synergy with other immune checkpoint molecules. When interacting with MHC class II LAG-3 transmits inhibitory signals that attenuate immune cell responses. Its role in immune regulation helps to balance immune activation and tolerance which is essential for preventing tissue damage while protecting against pathogens.

Pathways

The inhibitory role of LAG-3 integrates into the T cell receptor (TCR) signaling pathway and is also linked to the PD-1 signaling pathway. In TCR signaling LAG-3 negatively regulates T cell activation. LAG-3 is functionally related to proteins like PD-1 and CTLA-4 sharing similar roles in immune checkpoint pathways that are critical for maintaining immune balance.

LAG-3 has links to cancer and autoimmune diseases. In cancer LAG-3 expression on tumor-infiltrating lymphocytes correlates with immune evasion by tumors. This relationship appears in various cancers including melanoma and renal cell carcinoma. In autoimmune diseases LAG-3's expression on regulatory T cells helps control conditions such as multiple sclerosis. It collaborates with CTLA-4 in modulating immune responses that prevent excessive immune activation and tissue damage associated with autoimmunity.

일반 정보

기능

Lymphocyte activation gene 3 protein. Inhibitory receptor on antigen activated T-cells (PubMed : 20421648, PubMed : 35761082, PubMed : 7805750, PubMed : 8647185). Delivers inhibitory signals upon binding to ligands, such as MHC class II, its main ligand present at the surface of antigen-presenting cells (APCs), and FGL1, which is secreted by hepatocytes and certain types of tumor cells (PubMed : 30580966, PubMed : 32920841, PubMed : 35761082, PubMed : 39671469, PubMed : 7589152, PubMed : 8647185, PubMed : 9159144). Ligand-binding initiates a signaling that inhibits the T-cell receptor (TCR) in the immunological synapse, preventing T-cell activation (PubMed : 40101708). Mechanistically, ligand-binding promotes (1) ubiquitination of the KIEELE motif, unleashing the RRFSALE motif from the membrane and (2) leading to the formation of condensates with the TCR component CD3E, thereby disrupting the association between CD3E and LCK and preventing TCR activation (PubMed : 40101708, PubMed : 40592325). May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1 (By similarity). Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells (PubMed : 20421648, PubMed : 7805750, PubMed : 8647185). Also mediates immune tolerance : constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function (By similarity). Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation (By similarity).. The LAG3-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 35981087, PubMed : 40101708). The blockage of the LAG3- and PDCD1-mediated pathways results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (PubMed : 35981087, PubMed : 40101708).. Secreted lymphocyte activation gene 3 protein. May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.

서열 유사성

Belongs to the LAG3 family.

Post-translational modifications

Lymphocyte activation gene 3 protein. Ubiquitinated by CBL and CBLB in response to ligand-binding, initiating a signaling that prevents TCR activation: ubiquitination at Lys-498 via 'Lys-63'-linked ubiquitin chains unleashes the RRFSALE motif from the membrane (PubMed:40101708). MHC class II and membrane-bound FGL1 promote ubiquitination by CBL and CBLB; in contrast secreted FGL1 is not able to trigger LAG3 ubiquitination (PubMed:40101708).. Lymphocyte activation gene 3 protein. Proteolytically cleaved by ADAM10 and ADAM17 within the connecting peptide region, leading to release of Secreted lymphocyte activation gene 3 protein (sLAG-3). ADAM10 mediates constitutive cleavage, but cleavage increases following T-cell activation, whereas shedding by ADAM17 is induced by TCR signaling in a PRKCQ-dependent manner.

제품 프로토콜

타겟 정보

Lymphocyte activation gene 3 protein. Inhibitory receptor on antigen activated T-cells (PubMed : 20421648, PubMed : 35761082, PubMed : 7805750, PubMed : 8647185). Delivers inhibitory signals upon binding to ligands, such as MHC class II, its main ligand present at the surface of antigen-presenting cells (APCs), and FGL1, which is secreted by hepatocytes and certain types of tumor cells (PubMed : 30580966, PubMed : 32920841, PubMed : 35761082, PubMed : 39671469, PubMed : 7589152, PubMed : 8647185, PubMed : 9159144). Ligand-binding initiates a signaling that inhibits the T-cell receptor (TCR) in the immunological synapse, preventing T-cell activation (PubMed : 40101708). Mechanistically, ligand-binding promotes (1) ubiquitination of the KIEELE motif, unleashing the RRFSALE motif from the membrane and (2) leading to the formation of condensates with the TCR component CD3E, thereby disrupting the association between CD3E and LCK and preventing TCR activation (PubMed : 40101708, PubMed : 40592325). May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1 (By similarity). Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells (PubMed : 20421648, PubMed : 7805750, PubMed : 8647185). Also mediates immune tolerance : constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function (By similarity). Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation (By similarity).. The LAG3-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 35981087, PubMed : 40101708). The blockage of the LAG3- and PDCD1-mediated pathways results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (PubMed : 35981087, PubMed : 40101708).. Secreted lymphocyte activation gene 3 protein. May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.
See full target information LAG3

대체 명칭 보기

CD223, FDC, LAG3, Lymphocyte activation gene 3 protein, LAG-3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com