JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235807

Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) is a Human Fragment protein, in the 3401 to 3692 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

KIAA0533, KIAA1907, LAMA5, Laminin subunit alpha-5, Laminin-10 subunit alpha, Laminin-11 subunit alpha, Laminin-15 subunit alpha

3 이미지
Mass Spectrometry - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235807 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Laminin alpha 5/LAMA5.

Mass Spectrometry - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235807 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Laminin alpha 5/LAMA5.

SDS-PAGE - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Laminin alpha 5/LAMA5 protein (Tagged) (AB235807)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab235807.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as Laminin alpha 5

서열 정보

[{"linker":null,"sequence":"FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC","proteinLength":"Fragment","predictedMolecularWeight":"47.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":3692,"aminoAcidStart":3401,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15230","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Laminin alpha 5 (LAMA5) also known as laminin alpha-5 chain is an important component of the basement membrane which provides structural support to tissues. LAMA5 is a subunit of the laminin protein a large heterotrimeric glycoprotein complex involved in numerous cellular processes. The molecular weight of laminin alpha 5 can reach approximately 400 kDa. This protein is expressed widely across various tissues including the kidney lung and skin where it plays a mechanical role by mediating cell adhesion differentiation and migration by forming a scaffold-like structure at the cellular level.
Biological function summary

Laminin alpha 5 participates in the assembly of the laminin-511 complex which is vital for tissue-specific functions and maintaining cellular structures. This complex is important for epithelial and endothelial cell stability ensuring cohesive interactions with integrins and other cellular receptors. Laminin alpha 5 as part of this complex promotes development wound healing and angiogenesis impacting cell survival and regeneration by providing essential biochemical signals through its binding sites.

Pathways

Laminin alpha 5 significantly influences the PI3K/AKT and MAPK pathways which are critical for cell proliferation and survival. Within these pathways LAMA5 interacts with integrin receptors facilitating signal transduction. These pathways further associate laminin alpha 5 with proteins like FAK and Src kinase which mediate downstream signaling events influencing cellular growth and adhesion. These pathways link laminin alpha 5 to diverse cellular functions and regulatory processes.

Laminin alpha 5 has implications in diseases such as renal fibrosis and epidermolysis bullosa. Aberrant expression or mutations of LAMA5 can lead to defective basement membrane integrity affecting tissue stability and function. In renal fibrosis alterations in LAMA5 associate with disrupted kidney architecture while in epidermolysis bullosa laminin alpha 5 mutations lead to skin fragility. These conditions can also involve interactions with proteins like collagen IV and integrins contributing to the disease pathology.

일반 정보

기능

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Plays a role in the regulation of skeletogenesis, through a mechanism that involves integrin-mediated signaling and PTK2B/PYK2 (PubMed : 33242826).

제품 프로토콜

타겟 정보

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Plays a role in the regulation of skeletogenesis, through a mechanism that involves integrin-mediated signaling and PTK2B/PYK2 (PubMed : 33242826).
See full target information LAMA5

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com