JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281816

Recombinant Human Leptin protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Leptin protein is a Human Full Length protein, in the 22 to 167 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC.

대체 명칭 보기

OB, OBS, LEP, Leptin, Obese protein, Obesity factor

3 이미지
Mass Spectrometry - Recombinant Human Leptin protein (AB281816)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Leptin protein (AB281816)

Mass determination by ESI-TOF.

Predicted MW is 16083.50 Da. (+/- 10 Da by ESI-TOF). Observes MW is 16084.40 Da. Additional masses at 15809.21 is due to residual O-glycans.

SDS-PAGE - Recombinant Human Leptin protein (AB281816)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Leptin protein (AB281816)

SDS-PAGE analysis of ab281816.

HPLC - Recombinant Human Leptin protein (AB281816)
  • HPLC

Supplier Data

HPLC - Recombinant Human Leptin protein (AB281816)

HPCL analysis of ab281816.

주요 정보

Purity

>95% SDS-PAGE

>95% by HPLC

Endotoxin 레벨

< 0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

HPLC, SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"GVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC","proteinLength":"Full Length","predictedMolecularWeight":"16 kDa","actualMolecularWeight":"16.08 kDa","aminoAcidEnd":167,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":null,"tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Leptin also known as the OB protein is a hormone with a molecular weight of approximately 16 kDa. Primarily it is produced by adipocytes in white adipose tissue and to a lesser extent in the placenta stomach and other tissues. This protein plays a significant role in energy homeostasis by conveying information to the central nervous system regarding fat storage. In scientific studies leptin is often measured using methods like the leptin ELISA kit or mouse leptin assay to monitor its levels and function.
Biological function summary

Leptin regulates food intake and energy expenditure by binding to its receptors in the hypothalamus. It is an important part of the feedback loop to manage body weight and appetite. Leptin is not part of a larger protein complex and acts directly on its target tissues. By signal transduction pathways it influences cellular processes such as metabolism and even impacts fertility and immune responses.

Pathways

Leptin is involved in the neuroendocrine signaling pathway and the MAPK/ERK pathway. In the neuroendocrine system leptin interacts with proteins like proopiomelanocortin (POMC) and neuropeptide Y (NPY) to manage appetite and energy use. Additionally it activates the JAK/STAT pathway when binding to its receptor which influences gene expression involved in metabolism and inflammation.

Leptin is linked to obesity and type 2 diabetes. Leptin deficiencies or resistance can lead to metabolic disorders as the hormone's signaling is disrupted affecting energy balance and storage. Its connection to adiponectin another hormone derived from fat tissue is critical in understanding these conditions; while leptin promotes inflammation adiponectin has anti-inflammatory effects. Exploring these proteins' roles and their balance offers insights into treatments for obesity-related disorders.

일반 정보

기능

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed : 15899045, PubMed : 17344214, PubMed : 19688109). In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed : 11460888, PubMed : 19688109, PubMed : 24340098, PubMed : 25060689, PubMed : 8589726). In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity). In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption (PubMed : 24340098). Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity) (PubMed : 17344214). May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (PubMed : 18242580). Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) (PubMed : 11460888). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (PubMed : 12504075). Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 which promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38 (PubMed : 15899045, PubMed : 19688109). In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity). Increases CD4(+)CD25(-) T-cell proliferation and reduces autophagy during TCR (T-cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation (PubMed : 25060689).

서열 유사성

Belongs to the leptin family.

제품 프로토콜

타겟 정보

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed : 15899045, PubMed : 17344214, PubMed : 19688109). In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed : 11460888, PubMed : 19688109, PubMed : 24340098, PubMed : 25060689, PubMed : 8589726). In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity). In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption (PubMed : 24340098). Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity) (PubMed : 17344214). May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (PubMed : 18242580). Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) (PubMed : 11460888). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (PubMed : 12504075). Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 which promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38 (PubMed : 15899045, PubMed : 19688109). In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity). Increases CD4(+)CD25(-) T-cell proliferation and reduces autophagy during TCR (T-cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation (PubMed : 25060689).
See full target information LEP

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com