JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB287941

Recombinant Human LIF protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human LIF protein (Active) is a Human Full Length protein, in the 23 to 202 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

대체 명칭 보기

HILDA, LIF, Leukemia inhibitory factor, Differentiation-stimulating factor, Melanoma-derived LPL inhibitor, D factor, MLPLI

5 이미지
Mass Spectrometry - Recombinant Human LIF protein (Active) (AB287941)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human LIF protein (Active) (AB287941)

ESI-TOF analysis of ab287941.

Predicted MW is 19772.92 Da (+/- 10 Da by ESI-TOF). Observed MW is 19777.88 Da.

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)

Functional analysis of ab287941.

Fully biologically active determined by the dose dependent proliferation of TF-1 cells. ED50 is ≤0.16 ng/mL, corresponding to a specific activity of of 6.25 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3424610-1

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)
  • FuncS

Lab

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)

Fully biologically active determined by dose dependent proliferation of TF-1 cells. ED50 is ≤ 0.16 ng/ml, corresponding to a specific activity of 6.25x106 units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3424610-1

HPLC - Recombinant Human LIF protein (Active) (AB287941)
  • HPLC

Supplier Data

HPLC - Recombinant Human LIF protein (Active) (AB287941)

HPLC analysis of ab287941.

SDS-PAGE - Recombinant Human LIF protein (Active) (AB287941)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LIF protein (Active) (AB287941)

SDS-PAGE analysis of ab287941.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC =95%

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS, Mass Spec, HPLC, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of TF-1 cells. ED50 is ≤0.16 ng/mL, corresponding to a specific activity of of 6.25 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF","proteinLength":"Full Length","predictedMolecularWeight":"19.77 kDa","actualMolecularWeight":"19.78 kDa","aminoAcidEnd":202,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15018","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Leukemia Inhibitory Factor (LIF) also known as LIF protein plays a critical mechanical role in cell communication and survival. It is a glycoprotein with a molecular weight (LIF MW) generally around 19 kilodaltons. In various tissues particularly in the mouse LIF expression occurs in the bone marrow muscle and notably the nervous system. Besides its presence in normal tissues it shows up in embryonic stem cells where it maintains their pluripotency in culture conditions.
Biological function summary

LIF influences cell differentiation growth and inflammatory response. As part of the interleukin-6 cytokine family LIF exerts its effects through a receptor complex involving LIFR (LIF receptor) and GP130. The LIF protein's signaling controls processes like neuronal cell differentiation and bone formation. It impacts hematopoietic cells and supports embryonic implantation and placental development by preparing the uterine environment.

Pathways

The LIF protein is essential in the JAK/STAT signaling pathway which regulates gene expression vital for survival and proliferation. It also interacts with the MAPK/ERK pathway ensuring diverse cellular responses. These pathways link LIF to related proteins like STAT3 and ERK1/2 which mediate further downstream effects. The interplay between these signaling cascades highlights LIF's role in managing cell survival and proliferation in various contexts.

LIF contributes to physiological and pathological states. In cancer such as leukemia LIF influences tumor growth and cancer cell survival. The interaction with other cytokines like Interleukin-6 enhances its effect in oncogenic processes. In inflammatory diseases like rheumatoid arthritis LIF's role relates to inflammation and joint destruction. Understanding its interaction with inflammatory mediators can aid in targeted therapeutic strategies.

일반 정보

기능

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

서열 유사성

Belongs to the LIF/OSM family.

제품 프로토콜

타겟 정보

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
See full target information LIF

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com