JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB163372

Recombinant Human LRRC8A protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human LRRC8A protein (GST tag N-Terminus) is a Human Fragment protein, in the 711 to 810 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

KIAA1437, LRRC8, SWELL1, UNQ221/PRO247, LRRC8A, Volume-regulated anion channel subunit LRRC8A, Leucine-rich repeat-containing protein 8A, Swelling protein 1, HsLRRC8A

1 이미지
SDS-PAGE - Recombinant Human LRRC8A protein (GST tag N-Terminus) (AB163372)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LRRC8A protein (GST tag N-Terminus) (AB163372)

ab163372 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":810,"aminoAcidStart":711,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8IWT6","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The LRRC8A protein also known as SWELL1 plays a mechanical role as a component of the volume-regulated anion channel (VRAC). It has a molecular mass of approximately 104 kDa. The protein functions in transporting chloride ions across the plasma membrane helping to maintain cellular osmotic balance. LRRC8A is widely expressed in many tissues with high levels in the kidney heart and brain indicating its broad functional relevance across different organ systems.
Biological function summary

LRRC8A forms heteromeric complexes with related proteins LRRC8B LRRC8C LRRC8D and LRRC8E. These complexes constitute the VRAC channels which are important for regulating cell volume in response to osmotic changes a process called regulatory volume decrease. LRRC8A's involvement in this process is essential for cell survival under fluctuating environmental conditions as it prevents cellular swelling and lysis by allowing ions and osmolytes to exit the cell.

Pathways

Researchers have linked LRRC8A to the PI3K-AKT signaling pathway and the apoptotic pathway. In the context of the PI3K-AKT pathway LRRC8A contributes to cell survival and growth regulation interacting with proteins like AKT. Within the apoptotic pathway through VRAC activity LRRC8A plays a role in apoptosis regulation facilitating the release of apoptogenic factors that trigger programmed cell death when necessary.

Researchers have connected LRRC8A to conditions such as ischemia-reperfusion injury and cancer. In ischemia-reperfusion injury inadequate regulation by LRRC8A can lead to excessive cell swelling and damage upon reperfusion making it a potential therapeutic target. In cancer its role in cell growth pathways implicates LRRC8A in the uncontrolled proliferation seen in malignancies. Its association with VRAC partners like LRRC8D underpins its involvement in these disorders.

일반 정보

기능

Essential component of the volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 29769723). The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 30095067). Mediates efflux of amino acids, such as aspartate and glutamate, in response to osmotic stress (PubMed : 28193731). LRRC8A and LRRC8D are required for the uptake of the drug cisplatin (PubMed : 26530471). In complex with LRRC8C or LRRC8E, acts as a transporter of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol : mediates both import and export of 2'-3'-cGAMP, thereby promoting transfer of 2'-3'-cGAMP to bystander cells (PubMed : 33171122). In contrast, complexes containing LRRC8D inhibit transport of 2'-3'-cGAMP (PubMed : 33171122). Required for in vivo channel activity, together with at least one other family member (LRRC8B, LRRC8C, LRRC8D or LRRC8E); channel characteristics depend on the precise subunit composition (PubMed : 24790029, PubMed : 26824658, PubMed : 28193731). Can form functional channels by itself (in vitro) (PubMed : 26824658). Involved in B-cell development : required for the pro-B cell to pre-B cell transition (PubMed : 14660746). Also required for T-cell development (By similarity). Required for myoblast differentiation : VRAC activity promotes membrane hyperpolarization and regulates insulin-stimulated glucose metabolism and oxygen consumption (By similarity). Also acts as a regulator of glucose-sensing in pancreatic beta cells : VRAC currents, generated in response to hypotonicity- or glucose-induced beta cell swelling, depolarize cells, thereby causing electrical excitation, leading to increase glucose sensitivity and insulin secretion (PubMed : 29371604). Also plays a role in lysosome homeostasis by forming functional lysosomal VRAC channels in response to low cytoplasmic ionic strength condition : lysosomal VRAC channels are necessary for the formation of large lysosome-derived vacuoles, which store and then expel excess water to maintain cytosolic water homeostasis (PubMed : 31270356, PubMed : 33139539).

서열 유사성

Belongs to the LRRC8 family.

Post-translational modifications

N-glycosylated.

Subcellular localisation

Lysosome membrane

제품 프로토콜

타겟 정보

Essential component of the volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 29769723). The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 30095067). Mediates efflux of amino acids, such as aspartate and glutamate, in response to osmotic stress (PubMed : 28193731). LRRC8A and LRRC8D are required for the uptake of the drug cisplatin (PubMed : 26530471). In complex with LRRC8C or LRRC8E, acts as a transporter of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol : mediates both import and export of 2'-3'-cGAMP, thereby promoting transfer of 2'-3'-cGAMP to bystander cells (PubMed : 33171122). In contrast, complexes containing LRRC8D inhibit transport of 2'-3'-cGAMP (PubMed : 33171122). Required for in vivo channel activity, together with at least one other family member (LRRC8B, LRRC8C, LRRC8D or LRRC8E); channel characteristics depend on the precise subunit composition (PubMed : 24790029, PubMed : 26824658, PubMed : 28193731). Can form functional channels by itself (in vitro) (PubMed : 26824658). Involved in B-cell development : required for the pro-B cell to pre-B cell transition (PubMed : 14660746). Also required for T-cell development (By similarity). Required for myoblast differentiation : VRAC activity promotes membrane hyperpolarization and regulates insulin-stimulated glucose metabolism and oxygen consumption (By similarity). Also acts as a regulator of glucose-sensing in pancreatic beta cells : VRAC currents, generated in response to hypotonicity- or glucose-induced beta cell swelling, depolarize cells, thereby causing electrical excitation, leading to increase glucose sensitivity and insulin secretion (PubMed : 29371604). Also plays a role in lysosome homeostasis by forming functional lysosomal VRAC channels in response to low cytoplasmic ionic strength condition : lysosomal VRAC channels are necessary for the formation of large lysosome-derived vacuoles, which store and then expel excess water to maintain cytosolic water homeostasis (PubMed : 31270356, PubMed : 33139539).
See full target information LRRC8A

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com