JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB238242

Recombinant Human LY6E/SCA-2 protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human LY6E/SCA-2 protein (Tagged) is a Human Full Length protein, in the 21 to 101 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

9804, RIGE, SCA2, TSA1, LY6E, Lymphocyte antigen 6E, Ly-6E, Retinoic acid-induced gene E protein, Stem cell antigen 2, Thymic shared antigen 1, RIG-E, SCA-2, TSA-1

1 이미지
SDS-PAGE - Recombinant Human LY6E/SCA-2 protein (Tagged) (AB238242)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LY6E/SCA-2 protein (Tagged) (AB238242)

(Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238242.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Protein previously known as LY6E.

서열 정보

[{"linker":null,"sequence":"LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS","proteinLength":"Full Length","predictedMolecularWeight":"24.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":101,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q16553","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

LY6E also known as SCA-2 is a membrane protein known for its role in immune response. With a mass of approximately 15 kDa LY6E is expressed on the cell surface in various tissues including the immune system and some epithelial cells. The protein belongs to the LY6 family which is characterized by the presence of a Ly6/uPAR domain playing a part in cellular signaling and host defense mechanisms.
Biological function summary

LY6E has a significant impact on immune modulation and viral infection processes. It interacts with other immune-related proteins and contributes to the regulation of T-cell proliferation and differentiation. While LY6E is not a part of a multi-protein complex itself its activity can modify the function of immune cells and potentially alter immune responses. This makes it an important player in the context of both adaptive and innate immunity.

Pathways

LY6E participates in key immune signaling pathways particularly those related to interferon signaling and antiviral defense. It influences these pathways by interacting with components such as interferon-gamma and other cytokines which regulate immune cell behavior and response. LY6E affects the STAT pathway by indirectly modulating the activity of STAT1 a critical protein in immune response highlighting its importance in orchestrating immune dynamics.

LY6E has been implicated in several viral infections and cancers. Its expression alters during viral infections such as influenza and HIV where it may play a role in enhancing or suppressing viral replication. LY6E's interaction with other proteins like STAT1 and various viral envelope proteins could contribute to immune escape or disease progression. Moreover aberrant regulation of LY6E levels has connections with cancer progression affecting tumor immunity and potentially making it a target for therapeutic interventions.

일반 정보

기능

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation (By similarity). Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion (PubMed : 32641482). Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity (By similarity).. (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus (PubMed : 28130445). In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E (PubMed : 28130445, PubMed : 29610346). Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape (PubMed : 28130445, PubMed : 30190477).

제품 프로토콜

타겟 정보

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation (By similarity). Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion (PubMed : 32641482). Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity (By similarity).. (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus (PubMed : 28130445). In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E (PubMed : 28130445, PubMed : 29610346). Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape (PubMed : 28130445, PubMed : 30190477).
See full target information LY6E

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com