JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259396

Recombinant human M-CSF protein (Active)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant human M-CSF protein (Active) is a Human Fragment protein, in the 33 to 190 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.
4 이미지
Mass Spectrometry - Recombinant human M-CSF protein (Active) (AB259396)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human M-CSF protein (Active) (AB259396)

M + 1 Da (Calc mass 18513 Da)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human M-CSF protein (Active) (AB259396)
  • FuncS

Supplier Data

Functional Studies - Recombinant human M-CSF protein (Active) (AB259396)

Fully active compared to a standard. The ED50 as determined by the dose-dependant proliferation of MNFS-60 cells is 5.164ng/mL corresponding to a Specific Activity of 1.94 x 105 IU/mg.

HPLC - Recombinant human M-CSF protein (Active) (AB259396)
  • HPLC

Supplier Data

HPLC - Recombinant human M-CSF protein (Active) (AB259396)

Purity 100%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

SDS-PAGE - Recombinant human M-CSF protein (Active) (AB259396)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human M-CSF protein (Active) (AB259396)

SDS-PAGE analysis of ab259396.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

< 0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully active compared to a standard. The ED<sub>50</sub> as determined by the dose-dependant proliferation of MNFS-60 cells is 5.164ng/mL corresponding to a Specific Activity of 1.94 x 10<sup>5</sup> IU/mg.

Accession

P09603-1

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

서열 정보

[{"linker":null,"sequence":"EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN","proteinLength":"Fragment","predictedMolecularWeight":"18.51 kDa","actualMolecularWeight":"18.51 kDa","aminoAcidEnd":190,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P09603","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

M-CSF or macrophage colony-stimulating factor is a cytokine involved in the regulation of macrophage production. Alternative names for M-CSF include CSF-1 and colony-stimulating factor 1. The M-CSF protein has a molecular mass of approximately 18 to 22 kDa. M-CSF is mainly expressed in various tissues including the placenta kidney and bone marrow. It functions as a homodimer important for the survival proliferation and differentiation of mononuclear phagocyte lineage cells.
Biological function summary

M-CSF influences the production differentiation and function of macrophages and osteoclasts. It is not part of a large complex but interacts with its receptor the CSF1R (colony-stimulating factor 1 receptor) on the surface of target cells. This interaction promotes the survival and proliferation of the target cells playing significant roles in immune response and bone homeostasis by regulating osteoclast development.

Pathways

The interaction of M-CSF with its receptor is central to several biological pathways notably the immune system pathway and bone resorption pathway. Within these pathways the binding of M-CSF to CSF1R activates downstream signaling cascades such as the PI3K/AKT and MAPK pathways importantly affecting cell survival and differentiation. The M-CSF pathway intersects with other cytokines and factors like GM-CSF (granulocyte-macrophage colony-stimulating factor) which also regulate immune cell dynamics.

Dysregulation of M-CSF levels is implicated in conditions such as osteoporosis and certain cancers. In osteoporosis M-CSF's role in osteoclast development links to increased bone resorption leading to bone loss. In cancers M-CSF overexpression may facilitate tumor-associated macrophage infiltration therefore supporting tumor progression. The interaction with CSF1R is significant as it serves as a potential target for therapeutic strategies aimed at modulating macrophage activity in these diseases.

제품 프로토콜

타겟 정보

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
See full target information CSF1

대체 명칭 보기

Macrophage colony-stimulating factor 1, CSF-1, M-CSF, MCSF, Lanimostim, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF, CSF1

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록and refine your search

Cell death discovery 9:436 PubMed38040717

2023

Metallothionein 3 promotes osteoclast differentiation and survival by regulating the intracellular Zn concentration and NRF2 pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Shinkichi Arisumi,Toshifumi Fujiwara,Keitaro Yasumoto,Tomoko Tsutsui,Hirokazu Saiwai,Kazu Kobayakawa,Seiji Okada,Haibo Zhao,Yasuharu Nakashima
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com