JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB256086

Recombinant human Macrophage Inflammatory Protein 3 alpha (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human Macrophage Inflammatory Protein 3 alpha (Active) is a Human Full Length protein, in the 27 to 96 aa range, expressed in Escherichia coli, with >95%, <1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

LARC, MIP3A, SCYA20, CCL20, C-C motif chemokine 20, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, Small-inducible cytokine A20, MIP-3-alpha

1 이미지
SDS-PAGE - Recombinant human Macrophage Inflammatory Protein 3 alpha (Active) (AB256086)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Macrophage Inflammatory Protein 3 alpha (Active) (AB256086)

SDS-PAGE analysis of ab256086 (1 μg) under reducing (Lane 1) and non-reducing (Lane 2) conditions.

4-20% Tris-Glycine gel. Coomassie Blue staining.

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

<1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Primary human T cell chemotaxis.

Accession

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

보관 버퍼

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM","proteinLength":"Full Length","predictedMolecularWeight":"8 kDa","actualMolecularWeight":null,"aminoAcidEnd":96,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P78556","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Macrophage Inflammatory Protein 3 alpha (MIP-3 alpha) also known as CCL20 is a chemokine with a molecular mass of approximately 9 kDa. It plays a role in immune response by mediating chemotaxis of lymphocytes and dendritic cells. MIP-3 alpha is mainly expressed in liver lung and lymphoid organs including the lymph nodes and appendix. Its expression can be induced during inflammation in response to signaling molecules like tumor necrosis factor-alpha (TNF-alpha) and interleukin-1 beta (IL-1β).
Biological function summary

MIP-3 alpha contributes to the immune system by recruiting immune cells to sites of inflammation or injury. It is not part of a larger protein complex. Its main function is binding to the CCR6 receptor on target cells. This interaction mediates the migration and activation of the immune cells critical for initiating the immune response by increasing cell surface adhesion and motility. By drawing immune cells MIP-3 alpha significantly influences the body's capacity to fight infections and regulate inflammatory processes.

Pathways

MIP-3 alpha is integral to the inflammatory response and chemokine signaling pathways. It is involved in the immune system's adaptive response through its interaction with CCR6. This pathway overlaps with other chemokines such as MIP-1 and MIP-2 which also aid in immune cell recruitment. Furthermore MIP-3 alpha’s engagement in these pathways facilitates intercellular communication during immune responses pivotal for maintaining homeostasis and immune surveillance.

MIP-3 alpha has associations with inflammatory diseases like rheumatoid arthritis and inflammatory bowel disease. During these conditions elevated levels of MIP-3 alpha contribute to the recruitment of inflammatory cells which exacerbate symptoms. MIP-3 alpha also connects with other proteins such as TNF-alpha in these disease contexts enhancing inflammation and progression of these disorders. Targeting MIP-3 alpha and its associated pathways may provide therapeutic opportunities for alleviating these chronic inflammatory conditions.

일반 정보

기능

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed : 11035086, PubMed : 11352563, PubMed : 20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases (PubMed : 21376174). CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (PubMed : 11352563, PubMed : 9038201). Involved in the recruitment of both the pro-inflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity). C-terminal processed forms have been shown to be equally chemotactically active for leukocytes (PubMed : 11035086). Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed : 23765988, PubMed : 25122636). Inhibits proliferation of myeloid progenitors in colony formation assays (PubMed : 9129037). May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity). Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213 (PubMed : 12149255).

서열 유사성

Belongs to the intercrine beta (chemokine CC) family.

Post-translational modifications

C-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes.

제품 프로토콜

타겟 정보

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed : 11035086, PubMed : 11352563, PubMed : 20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases (PubMed : 21376174). CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (PubMed : 11352563, PubMed : 9038201). Involved in the recruitment of both the pro-inflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity). C-terminal processed forms have been shown to be equally chemotactically active for leukocytes (PubMed : 11035086). Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed : 23765988, PubMed : 25122636). Inhibits proliferation of myeloid progenitors in colony formation assays (PubMed : 9129037). May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity). Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213 (PubMed : 12149255).
See full target information CCL20

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com