JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114825

Recombinant Human MBNL1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human MBNL1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 343 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

EXP, KIAA0428, MBNL, MBNL1, Muscleblind-like protein 1, Triplet-expansion RNA-binding protein

1 이미지
SDS-PAGE - Recombinant Human MBNL1 protein (GST tag N-Terminus) (AB114825)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MBNL1 protein (GST tag N-Terminus) (AB114825)

12.5% SDS-PAGE Stained with Coomassie Blue

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein</p>" } } }

제품 세부 정보

This product was previously labelled as Muscleblind-like 1.

서열 정보

[{"linker":null,"sequence":"MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM","proteinLength":"Full Length","predictedMolecularWeight":"63.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":343,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NR56","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The MBNL1 protein also known as Muscleblind-like protein 1 or MBNL1 is a RNA-binding protein with a molecular mass of approximately 38 kDa. This protein has a central role in the regulation of alternative splicing. It binds to specific RNA motifs and affects the splicing of pre-mRNA. MBNL1 is expressed widely in many tissues including skeletal and cardiac muscles as well as the brain indicating its wide-ranging importance in various cellular processes.
Biological function summary

The MBNL1 protein is involved in the regulation of mRNA metabolism. It functions not just individually but often as a part of larger ribonucleic complexes impacting RNA stability and translation. MBNL1 controls the alternative splicing of numerous transcripts which is necessary for the proper development and function of tissues. Disruptions in MBNL1 activity can lead to mis-splicing of transcripts which demonstrates the key role it plays in maintaining cellular homeostasis.

Pathways

The MBNL1 protein contributes significantly to splicing regulation and muscle-specific gene expression pathways. It interacts with proteins like CELF1 which modulate pre-mRNA processing. These pathways are vital for muscle cell differentiation and maintenance with MBNL1 acting alongside other splicing factors to ensure the correct expression patterns necessary for tissue-specific functions. The balance between MBNL1 and its interacting partners influences splicing outcomes and gene expression.

The dysregulation of MBNL1 activity is implicated in myotonic dystrophy type 1 (DM1) and myotonic dystrophy type 2 (DM2). In these conditions expanded CUG or CCUG repeat RNAs sequester MBNL1 disrupting its function and leading to splicing abnormalities. Through this mechanism MBNL1 connects to other proteins like CUGBP1 which also influences splicing in muscle and other tissues. The resulting mis-splicing from impaired MBNL1 activity underlies many symptoms seen in these muscular disorders highlighting the protein's clinical relevance.

일반 정보

기능

Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues. Together with RNA binding proteins RBPMS and RBFOX2, activates vascular smooth muscle cells alternative splicing events (PubMed : 37548402). Regulates NCOR2 alternative splicing (By similarity).

서열 유사성

Belongs to the muscleblind family.

제품 프로토콜

타겟 정보

Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues. Together with RNA binding proteins RBPMS and RBFOX2, activates vascular smooth muscle cells alternative splicing events (PubMed : 37548402). Regulates NCOR2 alternative splicing (By similarity).
See full target information MBNL1

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Investigative ophthalmology & visual science 60:3980-3991 PubMed31560764

2019

Quantitative Studies of Muscleblind Proteins and Their Interaction With TCF4 RNA Foci Support Involvement in the Mechanism of Fuchs' Dystrophy.

Applications

Unspecified application

Species

Unspecified reactive species

Ziye Rong,Jiaxin Hu,David R Corey,V Vinod Mootha
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com