JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB318940

Recombinant Human Midkine Protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Midkine Protein (His tag) is a Human Full Length protein, expressed in Escherichia coli, 0.005 EU/µg endotoxin level, suitable for Mass Spec, SDS-PAGE.

대체 명칭 보기

MK1, NEGF2, MDK, Midkine, MK, Amphiregulin-associated protein, Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein, ARAP

2 이미지
Mass Spectrometry - Recombinant Human Midkine Protein (His tag) (AB318940)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Midkine Protein (His tag) (AB318940)

Mass determination by ESI-TOF. Predicted MW is 13480 Da (+/- 10 Da by ESI-TOF). Observed MW is 13477.43 Da.

SDS-PAGE - Recombinant Human Midkine Protein (His tag) (AB318940)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Midkine Protein (His tag) (AB318940)

SDS-PAGE analysis of ab318940 under reducing conditions for 2ug protein.

주요 정보

Purity

undefined HPLC

Endotoxin 레벨

0.005 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

Animal free

Yes

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS, 6.4993% Trehalose

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD","proteinLength":"Full Length","predictedMolecularWeight":"13.48 kDa","actualMolecularWeight":"13.48 kDa","aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P21741","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
False

일반 정보

기능

Secreted protein that functions as a cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed : 10212223, PubMed : 10772929, PubMed : 12084985, PubMed : 12122009, PubMed : 12573468, PubMed : 15466886, PubMed : 18469519, PubMed : 24458438). Binds cell-surface proteoglycan receptors via their chondroitin sulfate (CS) groups (PubMed : 10212223, PubMed : 12084985). Thereby regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration (PubMed : 10212223, PubMed : 10683378, PubMed : 10772929, PubMed : 12084985, PubMed : 12122009, PubMed : 12573468, PubMed : 15466886, PubMed : 22323540, PubMed : 24458438). Participates in inflammatory processes by exerting two different activities. Firstly, mediates neutrophils and macrophages recruitment to the sites of inflammation both by direct action by cooperating namely with ITGB2 via LRP1 and by inducing chemokine expression (PubMed : 10683378, PubMed : 24458438). This inflammation can be accompanied by epithelial cell survival and smooth muscle cell migration after renal and vessel damage, respectively (PubMed : 10683378). Secondly, suppresses the development of tolerogenic dendric cells thereby inhibiting the differentiation of regulatory T cells and also promote T cell expansion through NFAT signaling and Th1 cell differentiation (PubMed : 22323540). Promotes tissue regeneration after injury or trauma. After heart damage negatively regulates the recruitment of inflammatory cells and mediates cell survival through activation of anti-apoptotic signaling pathways via MAPKs and AKT pathways through the activation of angiogenesis (By similarity). Also facilitates liver regeneration as well as bone repair by recruiting macrophage at trauma site and by promoting cartilage development by facilitating chondrocyte differentiation (By similarity). Plays a role in brain by promoting neural precursor cells survival and growth through interaction with heparan sulfate proteoglycans (By similarity). Binds PTPRZ1 and promotes neuronal migration and embryonic neurons survival (PubMed : 10212223). Binds SDC3 or GPC2 and mediates neurite outgrowth and cell adhesion (PubMed : 12084985, PubMed : 1768439). Binds chondroitin sulfate E and heparin leading to inhibition of neuronal cell adhesion induced by binding with GPC2 (PubMed : 12084985). Binds CSPG5 and promotes elongation of oligodendroglial precursor-like cells (By similarity). Also binds ITGA6 : ITGB1 complex; this interaction mediates MDK-induced neurite outgrowth (PubMed : 15466886, PubMed : 1768439). Binds LRP1; promotes neuronal survival (PubMed : 10772929). Binds ITGA4 : ITGB1 complex; this interaction mediates MDK-induced osteoblast cells migration through PXN phosphorylation (PubMed : 15466886). Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation (PubMed : 12122009). Promotes epithelial to mesenchymal transition through interaction with NOTCH2 (PubMed : 18469519). During arteriogenesis, plays a role in vascular endothelial cell proliferation by inducing VEGFA expression and release which in turn induces nitric oxide synthase expression. Moreover activates vasodilation through nitric oxide synthase activation (By similarity). Negatively regulates bone formation in response to mechanical load by inhibiting Wnt/beta-catenin signaling in osteoblasts (By similarity). In addition plays a role in hippocampal development, working memory, auditory response, early fetal adrenal gland development and the female reproductive system (By similarity).

서열 유사성

Belongs to the pleiotrophin family.

제품 프로토콜

타겟 정보

Secreted protein that functions as a cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed : 10212223, PubMed : 10772929, PubMed : 12084985, PubMed : 12122009, PubMed : 12573468, PubMed : 15466886, PubMed : 18469519, PubMed : 24458438). Binds cell-surface proteoglycan receptors via their chondroitin sulfate (CS) groups (PubMed : 10212223, PubMed : 12084985). Thereby regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration (PubMed : 10212223, PubMed : 10683378, PubMed : 10772929, PubMed : 12084985, PubMed : 12122009, PubMed : 12573468, PubMed : 15466886, PubMed : 22323540, PubMed : 24458438). Participates in inflammatory processes by exerting two different activities. Firstly, mediates neutrophils and macrophages recruitment to the sites of inflammation both by direct action by cooperating namely with ITGB2 via LRP1 and by inducing chemokine expression (PubMed : 10683378, PubMed : 24458438). This inflammation can be accompanied by epithelial cell survival and smooth muscle cell migration after renal and vessel damage, respectively (PubMed : 10683378). Secondly, suppresses the development of tolerogenic dendric cells thereby inhibiting the differentiation of regulatory T cells and also promote T cell expansion through NFAT signaling and Th1 cell differentiation (PubMed : 22323540). Promotes tissue regeneration after injury or trauma. After heart damage negatively regulates the recruitment of inflammatory cells and mediates cell survival through activation of anti-apoptotic signaling pathways via MAPKs and AKT pathways through the activation of angiogenesis (By similarity). Also facilitates liver regeneration as well as bone repair by recruiting macrophage at trauma site and by promoting cartilage development by facilitating chondrocyte differentiation (By similarity). Plays a role in brain by promoting neural precursor cells survival and growth through interaction with heparan sulfate proteoglycans (By similarity). Binds PTPRZ1 and promotes neuronal migration and embryonic neurons survival (PubMed : 10212223). Binds SDC3 or GPC2 and mediates neurite outgrowth and cell adhesion (PubMed : 12084985, PubMed : 1768439). Binds chondroitin sulfate E and heparin leading to inhibition of neuronal cell adhesion induced by binding with GPC2 (PubMed : 12084985). Binds CSPG5 and promotes elongation of oligodendroglial precursor-like cells (By similarity). Also binds ITGA6 : ITGB1 complex; this interaction mediates MDK-induced neurite outgrowth (PubMed : 15466886, PubMed : 1768439). Binds LRP1; promotes neuronal survival (PubMed : 10772929). Binds ITGA4 : ITGB1 complex; this interaction mediates MDK-induced osteoblast cells migration through PXN phosphorylation (PubMed : 15466886). Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation (PubMed : 12122009). Promotes epithelial to mesenchymal transition through interaction with NOTCH2 (PubMed : 18469519). During arteriogenesis, plays a role in vascular endothelial cell proliferation by inducing VEGFA expression and release which in turn induces nitric oxide synthase expression. Moreover activates vasodilation through nitric oxide synthase activation (By similarity). Negatively regulates bone formation in response to mechanical load by inhibiting Wnt/beta-catenin signaling in osteoblasts (By similarity). In addition plays a role in hippocampal development, working memory, auditory response, early fetal adrenal gland development and the female reproductive system (By similarity).
See full target information MDK

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com