JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB205517

Recombinant human/mouse Ihh protein (Animal Free)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant human/mouse Ihh protein (Animal Free) is a Human Fragment protein, in the 29 to 202 aa range, expressed in Escherichia coli, with >97%, < 0.05 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

Indian hedgehog protein, IHH, HHG-2

1 이미지
SDS-PAGE - Recombinant human/mouse Ihh protein (Animal Free) (AB205517)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human/mouse Ihh protein (Animal Free) (AB205517)

SDS PAGE analysis of ab205517 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

주요 정보

Purity

>97% SDS-PAGE

Purity is typically 97% as determined by reducing and non-reducing SDS-PAGE.

Endotoxin 레벨

< 0.05 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 250 µL of 10 mM HCl

보관 버퍼

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product shares 100% homology with amino acids 29 -202 of Human IHH.

서열 정보

[{"linker":null,"sequence":"MIIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG","proteinLength":"Fragment","predictedMolecularWeight":"20 kDa","actualMolecularWeight":null,"aminoAcidEnd":202,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P97812","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon reconstitution add a carrier protein (0.1% BSA)
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The Indian hedgehog (Ihh) protein known by its gene symbol IHH plays key roles in cell signaling. Ihh with an approximate mass of 45 kDa belongs to the Hedgehog family of signaling molecules. It is expressed in various tissues including cartilage bone and parts of the gastrointestinal tract where it regulates growth and patterning. Ihh acts by binding to its receptor Patched triggering downstream signaling that influences cell fate decisions.
Biological function summary

Ihh is significant in regulating the differentiation and proliferation of chondrocytes in the growth plate of long bones. It acts as part of a complex regulatory network coordinating with Parathyroid hormone-related protein (PTHrP) to maintain proper development of endochondral bones. Ihh also influences epithelial and mesenchymal interactions during embryo development evidencing its important role in developmental biology.

Pathways

Ihh is a critical component of the Hedgehog signaling pathway a conserved pathway involved in embryonic development and adult tissue homeostasis. This pathway also includes proteins like Sonic hedgehog (Shh) and Desert hedgehog (Dhh) as well as the receptor Smoothened which mediates the signaling cascade. Ihh signaling impacts pathways such as the Wnt pathway influencing the proliferation and differentiation of cells thereby highlighting its integration into broader cellular signaling networks.

Ihh misregulation can lead to skeletal disorders like brachydactyly type A1 characterized by shortened fingers and toes. Furthermore abnormal Ihh signaling can contribute to certain cancers such as chondrosarcoma where overactive Hedgehog signaling promotes tumorigenesis. The relationship between Ihh and other Hedgehog proteins including Shh is key in understanding these pathologies as they share pathways that are often disrupted in disease scenarios.

일반 정보

기능

Plays a role in embryonic morphogenesis; it is involved in the regulation of endochondral skeleton formation, and the development of retinal pigment epithelium (RPE), photoreceptors and periocular tissues (By similarity).. Indian hedgehog protein. The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Plays a role in hedgehog paracrine signaling (PubMed : 24342078). Associated with the very-low-density lipoprotein (VLDL) particles to function as a circulating morphogen for endothelial cell integrity maintenance (PubMed : 20839884).. Indian hedgehog protein N-product. The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton (By similarity). Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway (By similarity).

서열 유사성

Belongs to the hedgehog family.

Post-translational modifications

Indian hedgehog protein N-product. Cholesterylation is required for N-product targeting to lipid rafts and multimerization.. Indian hedgehog protein. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). The N-product is the active species in both local and long-range signaling, whereas the C-product is degraded in the endoplasmic reticulum (By similarity).. Indian hedgehog protein N-product. N-palmitoylation by HHAT of N-product is required for indian hedgehog protein N-product multimerization and full activity.

제품 프로토콜

타겟 정보

Plays a role in embryonic morphogenesis; it is involved in the regulation of endochondral skeleton formation, and the development of retinal pigment epithelium (RPE), photoreceptors and periocular tissues (By similarity).. Indian hedgehog protein. The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Plays a role in hedgehog paracrine signaling (PubMed : 24342078). Associated with the very-low-density lipoprotein (VLDL) particles to function as a circulating morphogen for endothelial cell integrity maintenance (PubMed : 20839884).. Indian hedgehog protein N-product. The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton (By similarity). Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway (By similarity).
See full target information IHH

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Nature 609:136-143 PubMed35709828

2022

Spatial profiling of early primate gastrulation in utero.

Applications

Unspecified application

Species

Unspecified reactive species

Sophie Bergmann,Christopher A Penfold,Erin Slatery,Dylan Siriwardena,Charis Drummer,Stephen Clark,Stanley E Strawbridge,Keiko Kishimoto,Alice Vickers,Mukul Tewary,Timo N Kohler,Florian Hollfelder,Wolf Reik,Erika Sasaki,Rüdiger Behr,Thorsten E Boroviak
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com