JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158661

Recombinant Human MR1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human MR1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 201 to 300 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

Major histocompatibility complex class I-related protein 1, MHC class I-related protein 1, Class I histocompatibility antigen-like protein, MR1

1 이미지
SDS-PAGE - Recombinant Human MR1 protein (GST tag N-Terminus) (AB158661)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MR1 protein (GST tag N-Terminus) (AB158661)

ab158661 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":300,"aminoAcidStart":201,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q95460","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

MR1 also known as the MR1 receptor or MR1 protein is an important player in the immune system. It weighs around 37 kilodaltons. This protein expresses prominently in many tissues such as the liver lymphoid tissues and the intestine. MR1 binds a range of small molecules derived from vitamin B metabolites. It presents these metabolites to a specific group of immune cells known as mucosal-associated invariant T (MAIT) cells leading to their activation.
Biological function summary

MR1 varies its mechanism by forming complexes with antigens that lack traditional peptide structure. It performs a major role in the immune response particularly through its interactions with MAIT cells. These cells represent an important intersection between innate and adaptive immunity responding rapidly to many pathogen-associated metabolites presented by MR1. This response contributes importantly to host protection especially against microbial infections.

Pathways

MR1 is an integral component in the vitamin B antigen presentation pathway. It interacts significantly with other molecules involved in antigen presentation. MR1's function anchors it within the host-pathogen interaction pathways and connects with proteins like beta-2-microglobulin (β2M) which is important for surface expression. Its activity complements classical MHC pathways although it operates independently in presenting non-peptide antigens.

MR1 contributes to understanding certain autoimmune conditions and infectious diseases. It connects to infectious diseases such as tuberculosis where MAIT cell activation plays a critical role in the immune response. Additionally MR1 has links to inflammatory bowel disease (IBD) a condition where gut microbiota activation of MAIT cells through MR1 may influence the disease outcome. Understanding its role in these diseases can provide insights into how MR1 or related proteins might be targeted for therapeutic interventions.

일반 정보

기능

Antigen-presenting molecule specialized in displaying microbial pyrimidine-based metabolites to alpha-beta T cell receptors (TCR) on innate-type mucosal-associated invariant T (MAIT) cells (PubMed : 19416870, PubMed : 23457030, PubMed : 22692454, PubMed : 23051753, PubMed : 24101382, PubMed : 23846752, PubMed : 26795251). In complex with B2M preferentially presents riboflavin-derived metabolites to semi-invariant TRAV1.2 TCRs on MAIT cells, guiding immune surveillance of the microbial metabolome at mucosal epithelial barriers (PubMed : 20581831, PubMed : 24101382, PubMed : 24695216, PubMed : 26795251). Signature pyrimidine-based microbial antigens are generated via non-enzymatic condensation of metabolite intermediates of the riboflavin pathway with by-products arising from other metabolic pathways such as glycolysis. Typical potent antigenic metabolites are 5-(2-oxoethylideneamino)-6-D-ribitylaminouracil (5-OE-RU) and 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil (5-OP-RU), products of condensation of 5-amino-6-D-ribityaminouracil (5-A-RU) with glyoxal or methylglyoxal by-products, respectively (PubMed : 24695216, PubMed : 32958637, PubMed : 32709702). May present microbial antigens to various TRAV1-2-negative MAIT cell subsets, providing for unique recognition of diverse microbes, including pathogens that do not synthesize riboflavin (PubMed : 27527800, PubMed : 31113973). Upon antigen recognition, elicits rapid innate-type MAIT cell activation to eliminate pathogenic microbes by directly killing infected cells (PubMed : 23846752, PubMed : 24695216, PubMed : 27527800). During T cell development, drives thymic selection and post-thymic terminal differentiation of MAIT cells in a process dependent on commensal microflora (By similarity). Acts as an immune sensor of cancer cell metabolome (PubMed : 31959982). May present a tumor-specific or -associated metabolite essential for cancer cell survival to a 'pan-cancer' TCR consisting of TRAV38.2-DV8*TRAJ31 alpha chain paired with a TRBV25.1*TRBJ2.3 beta chain on a non-MAIT CD8-positive T cell clone (MC.7.G5), triggering T cell-mediated killing of a wide range of cancer cell types (PubMed : 31959982).. Allele MR1*01 : Presents microbial-derived metabolite 5-OP-RU to semi-invariant TRAV1.2-TRAJ33-TRBV6.1 (A-F7) TCR on MAIT cells (PubMed : 39589872). Presents nucleobase carbonyl adducts generated during oxidative stress. Captures M3Ade, a nucleobase adduct composed of one adenine modified by a malondialdehyde trimer, for recognition by MR1-restricted T cell clones expressing a polyclonal TCR repertoire (PubMed : 39701104). Displays moderate binding affinity toward tumor-enriched pyridoxal and pyridoxal 5'-phosphate antigens (PubMed : 39589872).. Allele MR1*04 : Presents tumor-enriched metabolite pyridoxal to pan-cancer 7.G5 TCR on T cells enabling preferential recognition of cancer cells. May act as an alloantigen.

서열 유사성

Belongs to the MHC class I family.

Post-translational modifications

N-glycosylated.

제품 프로토콜

타겟 정보

Antigen-presenting molecule specialized in displaying microbial pyrimidine-based metabolites to alpha-beta T cell receptors (TCR) on innate-type mucosal-associated invariant T (MAIT) cells (PubMed : 19416870, PubMed : 23457030, PubMed : 22692454, PubMed : 23051753, PubMed : 24101382, PubMed : 23846752, PubMed : 26795251). In complex with B2M preferentially presents riboflavin-derived metabolites to semi-invariant TRAV1.2 TCRs on MAIT cells, guiding immune surveillance of the microbial metabolome at mucosal epithelial barriers (PubMed : 20581831, PubMed : 24101382, PubMed : 24695216, PubMed : 26795251). Signature pyrimidine-based microbial antigens are generated via non-enzymatic condensation of metabolite intermediates of the riboflavin pathway with by-products arising from other metabolic pathways such as glycolysis. Typical potent antigenic metabolites are 5-(2-oxoethylideneamino)-6-D-ribitylaminouracil (5-OE-RU) and 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil (5-OP-RU), products of condensation of 5-amino-6-D-ribityaminouracil (5-A-RU) with glyoxal or methylglyoxal by-products, respectively (PubMed : 24695216, PubMed : 32958637, PubMed : 32709702). May present microbial antigens to various TRAV1-2-negative MAIT cell subsets, providing for unique recognition of diverse microbes, including pathogens that do not synthesize riboflavin (PubMed : 27527800, PubMed : 31113973). Upon antigen recognition, elicits rapid innate-type MAIT cell activation to eliminate pathogenic microbes by directly killing infected cells (PubMed : 23846752, PubMed : 24695216, PubMed : 27527800). During T cell development, drives thymic selection and post-thymic terminal differentiation of MAIT cells in a process dependent on commensal microflora (By similarity). Acts as an immune sensor of cancer cell metabolome (PubMed : 31959982). May present a tumor-specific or -associated metabolite essential for cancer cell survival to a 'pan-cancer' TCR consisting of TRAV38.2-DV8*TRAJ31 alpha chain paired with a TRBV25.1*TRBJ2.3 beta chain on a non-MAIT CD8-positive T cell clone (MC.7.G5), triggering T cell-mediated killing of a wide range of cancer cell types (PubMed : 31959982).. Allele MR1*01 : Presents microbial-derived metabolite 5-OP-RU to semi-invariant TRAV1.2-TRAJ33-TRBV6.1 (A-F7) TCR on MAIT cells (PubMed : 39589872). Presents nucleobase carbonyl adducts generated during oxidative stress. Captures M3Ade, a nucleobase adduct composed of one adenine modified by a malondialdehyde trimer, for recognition by MR1-restricted T cell clones expressing a polyclonal TCR repertoire (PubMed : 39701104). Displays moderate binding affinity toward tumor-enriched pyridoxal and pyridoxal 5'-phosphate antigens (PubMed : 39589872).. Allele MR1*04 : Presents tumor-enriched metabolite pyridoxal to pan-cancer 7.G5 TCR on T cells enabling preferential recognition of cancer cells. May act as an alloantigen.
See full target information MR1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com