JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114179

Recombinant Human mTOR protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human mTOR protein (GST tag N-Terminus) is a Human Fragment protein, in the 1521 to 1620 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

FRAP, FRAP1, FRAP2, RAFT1, RAPT1, MTOR, Serine/threonine-protein kinase mTOR, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, Mammalian target of rapamycin, Mechanistic target of rapamycin, Rapamycin and FKBP12 target 1, Rapamycin target protein 1, Tyrosine-protein kinase mTOR, mTOR

1 이미지
SDS-PAGE - Recombinant Human mTOR protein (GST tag N-Terminus) (AB114179)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human mTOR protein (GST tag N-Terminus) (AB114179)

ab114179 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

서열 정보

[{"linker":null,"sequence":"WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":1620,"aminoAcidStart":1521,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P42345","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The mammalian target of rapamycin commonly known as mTOR is a serine/threonine kinase known for its role in cellular growth and metabolism. It has a molecular weight of approximately 289 kDa. mTOR is expressed in various tissues throughout the body including muscle adipose tissue and the brain. The protein functions as a central regulator of cell proliferation protein synthesis and nutrient signaling. Often researchers utilize mTOR ELISA or mTOR western blot (mTOR WB) methods and mTOR antibodies to study its expression and activity in various biological contexts.
Biological function summary

MTOR integrates signals from nutrients growth factors and cellular energy status to maintain cellular homeostasis. It forms part of two distinct complexes mTORC1 and mTORC2 which differ in their component proteins and downstream effects. mTORC1 primarily responds to amino acids and regulates protein synthesis through phosphorylation of key substrates like S6K1. On the other hand mTORC2 is important for maintaining cytoskeletal integrity and cell survival highlighting the protein's importance in diverse cellular processes.

Pathways

MTOR plays a pivotal role in the PI3K/AKT/mTOR pathway which governs cell growth proliferation and survival. It also has implications in the regulation of the AMPK pathway which senses cellular energy levels. Through these pathways mTOR interacts with proteins such as AKT and TSC2. The phospho-mTOR specifically the S2448 phospho-mTOR serves as an important functional marker in these signaling cascades linking extracellular signals to downstream cellular responses.

MTOR has connections to cancer and neurodegenerative diseases. Its dysregulation often leads to uncontrolled cellular proliferation a hallmark of many cancers. Conditions such as tuberous sclerosis can occur due to mutations in proteins like TSC1 and TSC2 that regulate mTOR activity. In Alzheimer's disease mTOR's role in autophagy and protein synthesis becomes significant as imbalance may contribute to disease progression. Understanding these connections highlights the potential of targeting mTOR pathways therapeutically.

일반 정보

기능

Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals (PubMed : 12087098, PubMed : 12150925, PubMed : 12150926, PubMed : 12231510, PubMed : 12718876, PubMed : 14651849, PubMed : 15268862, PubMed : 15467718, PubMed : 15545625, PubMed : 15718470, PubMed : 18497260, PubMed : 18762023, PubMed : 18925875, PubMed : 20516213, PubMed : 20537536, PubMed : 21659604, PubMed : 23429703, PubMed : 23429704, PubMed : 25799227, PubMed : 26018084, PubMed : 29150432, PubMed : 29236692, PubMed : 31112131, PubMed : 31601708, PubMed : 32561715, PubMed : 34519269, PubMed : 37751742). MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins (PubMed : 15268862, PubMed : 15467718, PubMed : 17517883, PubMed : 18372248, PubMed : 18497260, PubMed : 18925875, PubMed : 20516213, PubMed : 21576368, PubMed : 21659604, PubMed : 23429704, PubMed : 30171069, PubMed : 29236692, PubMed : 37751742). Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2) (PubMed : 15268862, PubMed : 15467718, PubMed : 18497260, PubMed : 18925875, PubMed : 20516213, PubMed : 21576368, PubMed : 21659604, PubMed : 23429704, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In response to nutrients, growth factors or amino acids, mTORC1 is recruited to the lysosome membrane and promotes protein, lipid and nucleotide synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis (PubMed : 12087098, PubMed : 12150925, PubMed : 12150926, PubMed : 12231510, PubMed : 12718876, PubMed : 14651849, PubMed : 15268862, PubMed : 15467718, PubMed : 15545625, PubMed : 15718470, PubMed : 18497260, PubMed : 18762023, PubMed : 18925875, PubMed : 20516213, PubMed : 20537536, PubMed : 21659604, PubMed : 23429703, PubMed : 23429704, PubMed : 25799227, PubMed : 26018084, PubMed : 29150432, PubMed : 29236692, PubMed : 31112131, PubMed : 34519269). This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E) (PubMed : 24403073, PubMed : 29236692). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B, and the inhibitor of translation initiation PDCD4 (PubMed : 12087098, PubMed : 12150925, PubMed : 18925875, PubMed : 29150432, PubMed : 29236692). Stimulates the pyrimidine biosynthesis pathway, both by acute regulation through RPS6KB1-mediated phosphorylation of the biosynthetic enzyme CAD, and delayed regulation, through transcriptional enhancement of the pentose phosphate pathway which produces 5-phosphoribosyl-1-pyrophosphate (PRPP), an allosteric activator of CAD at a later step in synthesis, this function is dependent on the mTORC1 complex (PubMed : 23429703, PubMed : 23429704). Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 an RNA polymerase III-repressor (PubMed : 20516213). Activates dormant ribosomes by mediating phosphorylation of SERBP1, leading to SERBP1 inactivation and reactivation of translation (PubMed : 36691768). In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1 (PubMed : 23426360). To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A (By similarity). In the same time, mTORC1 inhibits catabolic pathways : negatively regulates autophagy through phosphorylation of ULK1 (PubMed : 32561715). Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1 (PubMed : 32561715). Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP (PubMed : 20537536). Also prevents autophagy by phosphorylating RUBCNL/Pacer under nutrient-rich conditions (PubMed : 30704899). Prevents autophagy by mediating phosphorylation of AMBRA1, thereby inhibiting AMBRA1 ability to mediate ubiquitination of ULK1 and interaction between AMBRA1 and PPP2CA (PubMed : 23524951, PubMed : 25438055). mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor (PubMed : 21659604). Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules (PubMed : 12231510). The mTORC1 complex is inhibited in response to starvation and amino acid depletion (PubMed : 12150925, PubMed : 12150926, PubMed : 24403073, PubMed : 31695197). The non-canonical mTORC1 complex, which acts independently of RHEB, specifically mediates phosphorylation of MiT/TFE factors MITF, TFEB and TFE3 in the presence of nutrients, promoting their cytosolic retention and inactivation (PubMed : 22343943, PubMed : 22576015, PubMed : 22692423, PubMed : 24448649, PubMed : 32612235, PubMed : 36608670, PubMed : 36697823). Upon starvation or lysosomal stress, inhibition of mTORC1 induces dephosphorylation and nuclear translocation of TFEB and TFE3, promoting their transcription factor activity (PubMed : 22343943, PubMed : 22576015, PubMed : 22692423, PubMed : 24448649, PubMed : 32612235, PubMed : 36608670). The mTORC1 complex regulates pyroptosis in macrophages by promoting GSDMD oligomerization (PubMed : 34289345). MTOR phosphorylates RPTOR which in turn inhibits mTORC1 (By similarity). As part of the mTORC2 complex, MTOR transduces signals from growth factors to pathways involved in proliferation, cytoskeletal organization, lipogenesis and anabolic output (PubMed : 15268862, PubMed : 15467718, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In response to growth factors, mTORC2 phosphorylates and activates AGC protein kinase family members, including AKT (AKT1, AKT2 and AKT3), PKC (PRKCA, PRKCB and PRKCE) and SGK1 (PubMed : 15268862, PubMed : 15467718, PubMed : 21376236, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In contrast to mTORC1, mTORC2 is nutrient-insensitive (PubMed : 15467718). mTORC2 plays a critical role in AKT1 activation by mediating phosphorylation of different sites depending on the context, such as 'Thr-450', 'Ser-473', 'Ser-477' or 'Thr-479', facilitating the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDPK1/PDK1 which is a prerequisite for full activation (PubMed : 15718470, PubMed : 21376236, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957). mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422' (PubMed : 18925875). mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B (PubMed : 15268862). The mTORC2 complex also phosphorylates various proteins involved in insulin signaling, such as FBXW8 and IGF2BP1 (By similarity). May also regulate insulin signaling by acting as a tyrosine protein kinase that catalyzes phosphorylation of IGF1R and INSR; additional evidence are however required to confirm this result in vivo (PubMed : 26584640). Regulates osteoclastogenesis by adjusting the expression of CEBPB isoforms (By similarity). Plays an important regulatory role in the circadian clock function; regulates period length and rhythm amplitude of the suprachiasmatic nucleus (SCN) and liver clocks (By similarity).

서열 유사성

Belongs to the PI3/PI4-kinase family.

Post-translational modifications

Autophosphorylates when part of mTORC1 or mTORC2 (PubMed:15467718, PubMed:20022946, PubMed:9434772). Phosphorylation at Ser-1261, Ser-2159 and Thr-2164 promotes autophosphorylation (PubMed:19487463). Phosphorylated at Ser-2448 by RPS6KB1 (PubMed:15899889, PubMed:15905173, PubMed:19145465). Phosphorylation in the kinase domain modulates the interactions of MTOR with RPTOR and AKT1S1/PRAS40 and leads to increased intrinsic mTORC1 kinase activity (PubMed:15905173, PubMed:19145465, PubMed:21576368). Phosphorylation at Ser-2159 by TBK1 in response to growth factors and pathogen recognition receptors promotes mTORC1 activity (PubMed:29150432). Phosphorylation at Ser-2159 by TBK1 in response to EGF growth factor promotes mTORC2 activity, leading to AKT1 phosphorylation and activation (By similarity). Phosphorylation at Thr-2173 in the ATP-binding region by AKT1 strongly reduces kinase activity (PubMed:24247430).. Ubiquitinated at Lys-2066 by the SCF(FBXO22) complex via 'Lys-27'-linked ubiquitination prevents mTORC1 substrate recruitment.

Subcellular localisation

Lysosome membrane

제품 프로토콜

타겟 정보

Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals (PubMed : 12087098, PubMed : 12150925, PubMed : 12150926, PubMed : 12231510, PubMed : 12718876, PubMed : 14651849, PubMed : 15268862, PubMed : 15467718, PubMed : 15545625, PubMed : 15718470, PubMed : 18497260, PubMed : 18762023, PubMed : 18925875, PubMed : 20516213, PubMed : 20537536, PubMed : 21659604, PubMed : 23429703, PubMed : 23429704, PubMed : 25799227, PubMed : 26018084, PubMed : 29150432, PubMed : 29236692, PubMed : 31112131, PubMed : 31601708, PubMed : 32561715, PubMed : 34519269, PubMed : 37751742). MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins (PubMed : 15268862, PubMed : 15467718, PubMed : 17517883, PubMed : 18372248, PubMed : 18497260, PubMed : 18925875, PubMed : 20516213, PubMed : 21576368, PubMed : 21659604, PubMed : 23429704, PubMed : 30171069, PubMed : 29236692, PubMed : 37751742). Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2) (PubMed : 15268862, PubMed : 15467718, PubMed : 18497260, PubMed : 18925875, PubMed : 20516213, PubMed : 21576368, PubMed : 21659604, PubMed : 23429704, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In response to nutrients, growth factors or amino acids, mTORC1 is recruited to the lysosome membrane and promotes protein, lipid and nucleotide synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis (PubMed : 12087098, PubMed : 12150925, PubMed : 12150926, PubMed : 12231510, PubMed : 12718876, PubMed : 14651849, PubMed : 15268862, PubMed : 15467718, PubMed : 15545625, PubMed : 15718470, PubMed : 18497260, PubMed : 18762023, PubMed : 18925875, PubMed : 20516213, PubMed : 20537536, PubMed : 21659604, PubMed : 23429703, PubMed : 23429704, PubMed : 25799227, PubMed : 26018084, PubMed : 29150432, PubMed : 29236692, PubMed : 31112131, PubMed : 34519269). This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E) (PubMed : 24403073, PubMed : 29236692). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B, and the inhibitor of translation initiation PDCD4 (PubMed : 12087098, PubMed : 12150925, PubMed : 18925875, PubMed : 29150432, PubMed : 29236692). Stimulates the pyrimidine biosynthesis pathway, both by acute regulation through RPS6KB1-mediated phosphorylation of the biosynthetic enzyme CAD, and delayed regulation, through transcriptional enhancement of the pentose phosphate pathway which produces 5-phosphoribosyl-1-pyrophosphate (PRPP), an allosteric activator of CAD at a later step in synthesis, this function is dependent on the mTORC1 complex (PubMed : 23429703, PubMed : 23429704). Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 an RNA polymerase III-repressor (PubMed : 20516213). Activates dormant ribosomes by mediating phosphorylation of SERBP1, leading to SERBP1 inactivation and reactivation of translation (PubMed : 36691768). In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1 (PubMed : 23426360). To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A (By similarity). In the same time, mTORC1 inhibits catabolic pathways : negatively regulates autophagy through phosphorylation of ULK1 (PubMed : 32561715). Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1 (PubMed : 32561715). Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP (PubMed : 20537536). Also prevents autophagy by phosphorylating RUBCNL/Pacer under nutrient-rich conditions (PubMed : 30704899). Prevents autophagy by mediating phosphorylation of AMBRA1, thereby inhibiting AMBRA1 ability to mediate ubiquitination of ULK1 and interaction between AMBRA1 and PPP2CA (PubMed : 23524951, PubMed : 25438055). mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor (PubMed : 21659604). Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules (PubMed : 12231510). The mTORC1 complex is inhibited in response to starvation and amino acid depletion (PubMed : 12150925, PubMed : 12150926, PubMed : 24403073, PubMed : 31695197). The non-canonical mTORC1 complex, which acts independently of RHEB, specifically mediates phosphorylation of MiT/TFE factors MITF, TFEB and TFE3 in the presence of nutrients, promoting their cytosolic retention and inactivation (PubMed : 22343943, PubMed : 22576015, PubMed : 22692423, PubMed : 24448649, PubMed : 32612235, PubMed : 36608670, PubMed : 36697823). Upon starvation or lysosomal stress, inhibition of mTORC1 induces dephosphorylation and nuclear translocation of TFEB and TFE3, promoting their transcription factor activity (PubMed : 22343943, PubMed : 22576015, PubMed : 22692423, PubMed : 24448649, PubMed : 32612235, PubMed : 36608670). The mTORC1 complex regulates pyroptosis in macrophages by promoting GSDMD oligomerization (PubMed : 34289345). MTOR phosphorylates RPTOR which in turn inhibits mTORC1 (By similarity). As part of the mTORC2 complex, MTOR transduces signals from growth factors to pathways involved in proliferation, cytoskeletal organization, lipogenesis and anabolic output (PubMed : 15268862, PubMed : 15467718, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In response to growth factors, mTORC2 phosphorylates and activates AGC protein kinase family members, including AKT (AKT1, AKT2 and AKT3), PKC (PRKCA, PRKCB and PRKCE) and SGK1 (PubMed : 15268862, PubMed : 15467718, PubMed : 21376236, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957, PubMed : 35926713). In contrast to mTORC1, mTORC2 is nutrient-insensitive (PubMed : 15467718). mTORC2 plays a critical role in AKT1 activation by mediating phosphorylation of different sites depending on the context, such as 'Thr-450', 'Ser-473', 'Ser-477' or 'Thr-479', facilitating the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDPK1/PDK1 which is a prerequisite for full activation (PubMed : 15718470, PubMed : 21376236, PubMed : 24670654, PubMed : 29424687, PubMed : 29567957). mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422' (PubMed : 18925875). mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B (PubMed : 15268862). The mTORC2 complex also phosphorylates various proteins involved in insulin signaling, such as FBXW8 and IGF2BP1 (By similarity). May also regulate insulin signaling by acting as a tyrosine protein kinase that catalyzes phosphorylation of IGF1R and INSR; additional evidence are however required to confirm this result in vivo (PubMed : 26584640). Regulates osteoclastogenesis by adjusting the expression of CEBPB isoforms (By similarity). Plays an important regulatory role in the circadian clock function; regulates period length and rhythm amplitude of the suprachiasmatic nucleus (SCN) and liver clocks (By similarity).
See full target information MTOR

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com