JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114218

Recombinant Human Mucin 5AC protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Mucin 5AC protein (GST tag N-Terminus) is a Human Fragment protein, in the 5528 to 5627 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

MUC5, MUC5AC, Mucin-5AC, MUC-5AC, Gastric mucin, Major airway glycoprotein, Tracheobronchial mucin, TBM

1 이미지
SDS-PAGE - Recombinant Human Mucin 5AC protein (GST tag N-Terminus) (AB114218)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Mucin 5AC protein (GST tag N-Terminus) (AB114218)

ab114218 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":5627,"aminoAcidStart":5528,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P98088","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Mucin 5AC also known simply as MUC5AC is a high molecular weight glycoprotein with a mass in the megadaltons typically found in the human respiratory gastrointestinal and reproductive tracts. It is a major component of mucus which plays a critical role in protecting and lubricating the epithelial surfaces of these organs. MUC5AC is primarily expressed in the goblet cells of the respiratory epithelium and the stomach lining. Due to its significance researchers often use a MUC5AC ELISA or other detection methods such as tagging with Alexa Fluor 555 to measure its levels in various tissues.
Biological function summary

The functions of MUC5AC are central to the maintenance of the protective mucus barrier on epithelial surfaces preventing pathogen invasion and facilitating the clearance of inhaled particles. It is a part of the gel-forming mucin family and often forms complex structures by polymerizing with other mucins like MUC2 and MUC5B contributing to the viscoelastic properties of mucus. These interactions ensure the formation of a stable and robust mucosal barrier.

Pathways

The regulation of MUC5AC production involves several signaling pathways including the EGFR (epidermal growth factor receptor) pathway and the IL-13/STAT6 pathway. These pathways influence mucin production and secretion particularly in response to growth factors and inflammatory cytokines. Proteins such as 13M1 and 11M1 interact with MUC5AC within these pathways modulating its expression and function. This regulation is essential for normal mucus homeostasis and response to environmental challenges.

MUC5AC has a strong association with respiratory conditions like asthma and chronic obstructive pulmonary disease (COPD). In these diseases the overproduction or altered composition of MUC5AC contributes to airway obstruction and reduced pulmonary function. MUC5AC levels can be indicative of disease severity and are often measured via tests like the 5AC blood test. In these contexts proteins such as 5AC protein and 45M1 are often studied for their roles in facilitating disease progression and as potential therapeutic targets to modulate mucin levels in affected individuals.

일반 정보

기능

Gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system (PubMed : 14535999, PubMed : 14718370). Interacts with H.pylori in the gastric epithelium, Barrett's esophagus as well as in gastric metaplasia of the duodenum (GMD) (PubMed : 14535999).

Post-translational modifications

C-, O- and N-glycosylated (PubMed:14718370). O-glycosylated on the second and last Thr of the Thr-/Ser-rich tandem repeats TTPSPVPTTSTTSA (PubMed:14718370, PubMed:22186971, PubMed:25939779). One form of glycosylation is also known as Lewis B (LeB) blood group antigen, a tetrasaccharide consisting of N-acetylglucosamine having a fucosyl residue attached (PubMed:14535999). It has a role as an epitope and antigen and functions as a receptor for H.pylori binding and facilitates infection (PubMed:14535999). C-mannosylation in the Cys-rich subdomains may be required for proper folding of these regions and for export from the endoplasmic reticulum during biosynthesis (PubMed:14718370).. Proteolytic cleavage in the C-terminal is initiated early in the secretory pathway and does not involve a serine protease. The extent of cleavage is increased in the acidic parts of the secretory pathway. Cleavage generates a reactive group which could link the protein to a primary amide.

제품 프로토콜

타겟 정보

Gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system (PubMed : 14535999, PubMed : 14718370). Interacts with H.pylori in the gastric epithelium, Barrett's esophagus as well as in gastric metaplasia of the duodenum (GMD) (PubMed : 14535999).
See full target information MUC5AC

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com