JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB136361

Recombinant Human NEK7 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NEK7 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 302 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Serine/threonine-protein kinase Nek7, Never in mitosis A-related kinase 7, NimA-related protein kinase 7, NEK7

1 이미지
SDS-PAGE - Recombinant Human NEK7 protein (His tag N-Terminus) (AB136361)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NEK7 protein (His tag N-Terminus) (AB136361)

15% SDS-PAGE analysis of ab136361 (3 μg)

주요 정보

Purity

>90% SDS-PAGE

ab136361 was purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS","proteinLength":"Full Length","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":302,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8TDX7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The NIMA-related kinase 7 (NEK7) is a member of the NEK family of serine/threonine kinases and plays an important role in cell division. With a molecular mass of approximately 34 kDa the NEK7 protein is involved in mitosis by regulating microtubule organization. It is primarily expressed in various tissues including human and marmoset thyroid tissues. It remains mainly inactive until mitotic entry where its activity becomes essential for proper spindle formation and completion of mitosis.
Biological function summary

Cell cycle progression heavily depends on NEK7's function. NEK7 interacts with NEDD1 in the microtubule-organizing center contributing to centrosome maturation and separation. This interaction makes NEK7 vital in the recruitment of γ-tubulin ring complex which is necessary for nucleating microtubules. NEK7 operates independently from the other NEK family members but shares involvement in centrosome-related activities.

Pathways

NEK7 is influential in the regulation of the mitotic spindle assembly pathway and the interleukin-1 (IL-1) signaling pathway. It is closely related to proteins like NEK6 and NEK9 which also play roles in mitotic progression and cytokinesis. NEK7's involvement in these pathways indicates its integrative function in ensuring normal cell division and response to inflammatory signals.

NEK7 has implications in cancer and inflammatory ailments. NEK7 overexpression or mutation is often linked to tumorigenesis particularly in lung and brain cancers. Additionally NEK7 contributes to the activation of the NLRP3 inflammasome connecting it to inflammatory conditions like rheumatoid arthritis. The interplay with NLRP3 highlights the significance of NEK7 in inflammation-related diseases.

일반 정보

기능

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502, PubMed : 39173637). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502, PubMed : 39173637, PubMed : 40450990). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).

서열 유사성

Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.

Post-translational modifications

Phosphorylation at Ser-195 required for its activation.

제품 프로토콜

타겟 정보

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502, PubMed : 39173637). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502, PubMed : 39173637, PubMed : 40450990). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).
See full target information NEK7

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com