JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158986

Recombinant Human Neurofilament heavy polypeptide protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Neurofilament heavy polypeptide protein (GST tag N-Terminus) is a Human Fragment protein, in the 263 to 363 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

KIAA0845, NFH, NEFH, Neurofilament heavy polypeptide, NF-H, 200 kDa neurofilament protein, Neurofilament triplet H protein

1 이미지
SDS-PAGE - Recombinant Human Neurofilament heavy polypeptide protein (GST tag N-Terminus) (AB158986)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Neurofilament heavy polypeptide protein (GST tag N-Terminus) (AB158986)

ab158986 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"LKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":363,"aminoAcidStart":263,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P12036","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Neurofilament heavy polypeptide often referred to as NF-H or neurofilament heavy chain plays an important role in the structural integrity of neurons. This protein is a critical component of the cytoskeleton in neurons consisting of an approximate molecular mass of 200 kDa. It is predominantly expressed in the neuronal axons where it contributes to the assembly and stability of neurofilament structures. NF-H is essential for maintaining axonal diameter and for proper conduction of electrical impulses along nerve fibers.
Biological function summary

This polypeptide participates in the formation of neurofilament a complex structure that includes other neurofilament proteins like the neurofilament light (NF-L) and neurofilament medium (NF-M). These proteins form a stable scaffold within the axon aiding in neuronal growth and repair. The phosphorylation of NF-H modulates its interactions within the neurofilament network influencing axonal transport processes and dynamics which are vital for neuron function and survival.

Pathways

Neurofilament heavy polypeptide is integral to the axonal transport pathway important in conveying molecules between the neuronal cell body and the synaptic terminals. Through its interactions with microtubules and motor proteins NF-H facilitates the movement of organelles and neurotransmitters. It has significant associations with proteins involved in the ubiquitin-proteasome system reflecting its role in maintaining neuronal homeostasis and proteostasis essential in neuronal development and function.

Neurofilament heavy polypeptide serves as an important biomarker for neurodegenerative disorders such as Amyotrophic Lateral Sclerosis (ALS) and Alzheimer's disease. NF-H especially in phosphorylated form accumulates in conditions of axonal injury or degeneration. It often interacts with tau protein in Alzheimer's pathology forming neurofibrillary tangles. Elevated levels of NF-H in cerebrospinal fluid or blood can indicate neuronal damage offering insights into disease progression and potential targets for therapeutic intervention.

일반 정보

기능

Neurofilaments usually contain three intermediate filament proteins : NEFL, NEFM, and NEFH which are involved in the maintenance of neuronal caliber. NEFH has an important function in mature axons that is not subserved by the two smaller NF proteins. May additionally cooperate with the neuronal intermediate filament proteins PRPH and INA to form neuronal filamentous networks (By similarity).

서열 유사성

Belongs to the intermediate filament family.

Post-translational modifications

There are a number of repeats of the tripeptide K-S-P, NFH is phosphorylated on a number of the serines in this motif. It is thought that phosphorylation of NFH results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.. Phosphorylation seems to play a major role in the functioning of the larger neurofilament polypeptides (NF-M and NF-H), the levels of phosphorylation being altered developmentally and coincidentally with a change in the neurofilament function.. Phosphorylated in the head and rod regions by the PKC kinase PKN1, leading to the inhibition of polymerization.

Subcellular localisation

Cytoskeleton

제품 프로토콜

타겟 정보

Neurofilaments usually contain three intermediate filament proteins : NEFL, NEFM, and NEFH which are involved in the maintenance of neuronal caliber. NEFH has an important function in mature axons that is not subserved by the two smaller NF proteins. May additionally cooperate with the neuronal intermediate filament proteins PRPH and INA to form neuronal filamentous networks (By similarity).
See full target information NEFH

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com