JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131674

Recombinant Human NKG2C protein (denatured) (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NKG2C protein (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 94 to 231 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

대체 명칭 보기

CD159c, NKG2C, KLRC2, NKG2-C type II integral membrane protein, CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor

1 이미지
SDS-PAGE - Recombinant Human NKG2C protein (denatured) (His tag N-Terminus) (AB131674)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NKG2C protein (denatured) (His tag N-Terminus) (AB131674)

15% SDS-PAGE analysis of 3 µg ab131674.

주요 정보

Purity

>85% SDS-PAGE

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMIPFLEQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL","proteinLength":"Fragment","predictedMolecularWeight":"18.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":231,"aminoAcidStart":94,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P26717","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

NKG2C also known as CD159c is a receptor protein that plays an important role in immune responses. This protein has an approximate mass of 30 kDa and is usually found on the surface of natural killer (NK) cells. NKG2C belongs to the family of C-type lectin receptors and forms heterodimers with the signaling adaptor protein DAP12. These heterodimers are expressed on NK cells and certain T cell subsets enabling the cells to recognize and respond to infected or transformed cells.
Biological function summary

NKG2C serves as an activating receptor for NK cells and certain T cells enhancing their cytotoxic functions. It participates in the recognition of cells expressing human cytomegalovirus (HCMV) proteins allowing the immune system to target and eliminate these infected cells efficiently. This receptor acts in a complex with DAP12 through which it transmits activation signals inside the immune cells. The engagement of NKG2C with its ligands initiates the production and release of cytokines and lytic granules promoting the destruction of target cells.

Pathways

NKG2C functions within the immune signaling pathways by interacting with other receptors and molecules on NK cells. The receptor is involved in pathways that activate NK cell-mediated cytotoxicity and cytokine production. NKG2C interacts with other natural killer receptors such as NKG2A and NKG2E contributing to the regulation of immune responses. The balance of signals from different receptors including NKG2C and NKG2A defines the activation and inhibition states of NK cells impacting both innate and adaptive immunity.

NKG2C expression has significance in viral infections and autoimmune diseases. In cases of viral infections like HCMV increased expression of NKG2C enhances the immune response against the virus by recognizing the virus-infected cells. In autoimmune disorders changes in NKG2C expression or function can alter immune regulation which may exacerbate disease conditions. NKG2C and its relationship with DAP12 as well as other immune receptors make it a valuable target for therapeutic interventions in these conditions.

일반 정보

기능

Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy (PubMed : 30134159, PubMed : 37264229, PubMed : 9754572). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed : 20952657, PubMed : 21825173). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed : 15940674, PubMed : 9655483).

제품 프로토콜

타겟 정보

Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy (PubMed : 30134159, PubMed : 37264229, PubMed : 9754572). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed : 20952657, PubMed : 21825173). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed : 15940674, PubMed : 9655483).
See full target information KLRC2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com