JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271635

Recombinant Human NLRP3 + NEK7 protein (7x His tag N-Term, DDDDK tag N-Term + Avi tag N-Term)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NLRP3 + NEK7 protein (7x His tag N-Term, DDDDK tag N-Term + Avi tag N-Term) is a Human Full Length protein, in the 2 to 302 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

Serine/threonine-protein kinase Nek7, Never in mitosis A-related kinase 7, NimA-related protein kinase 7, NEK7, C1orf7, CIAS1, NALP3, PYPAF1, NLRP3, Angiotensin/vasopressin receptor AII/AVP-like, Caterpiller protein 1.1, Cold-induced autoinflammatory syndrome 1 protein, Cryopyrin, PYRIN-containing APAF1-like protein 1, CLR1.1

1 이미지
SDS-PAGE - Recombinant Human NLRP3 + NEK7 protein (7x His tag N-Term, DDDDK tag N-Term + Avi tag N-Term) (AB271635)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human NLRP3 + NEK7 protein (7x His tag N-Term, DDDDK tag N-Term + Avi tag N-Term) (AB271635)

SDS-PAGE analysis of ab271635.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"DEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":302,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q8TDX7","tags":[{"tag":"7x His","terminus":"N-Terminus"}]},{"linker":null,"sequence":"KDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCTGLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1036,"aminoAcidStart":134,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q96P20","tags":[{"tag":"DDDDK","terminus":"N-Terminus"},{"tag":"Avi","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The NLRP3 protein also known as NACHT LRR and PYD domains-containing protein 3 and NEK7 known as NIMA-related kinase 7 play integral parts in cellular pathways. NLRP3 has a molecular mass of approximately 118 kDa and is expressed mainly in innate immune cells such as macrophages and dendritic cells. NEK7 with a mass around 34 kDa is largely expressed in dividing cells and performs important cellular roles during the cell cycle. These proteins are part of the NLRP3 inflammasome complex a critical component of the immune response which detects pathogenic microorganisms and stress signals.
Biological function summary

NLRP3 and NEK7 are involved in innate immunity playing key roles in inflammation. The NLRP3 inflammasome comprises NLRP3 ASC (apoptosis-associated speck-like protein containing a CARD) and pro-caspase-1. NEK7 acts as a positive regulator of NLRP3 inflammasome activation. This complex once formed leads to the activation of caspase-1 which then processes pro-inflammatory cytokines like IL-1β and IL-18 into their active forms. This process aids in the defense against infections but its dysregulation can result in excessive inflammation.

Pathways

NLRP3 and NEK7 are instrumental in the inflammasome and IL-1 signaling pathways. Within the inflammasome signaling NLRP3 acts as a pattern recognition receptor and its interaction with NEK7 is critical for sensing cell danger signals. This recognition and activation also involve other proteins such as ASC linking the inflammasome pathway to wider immune responses. The IL-1 signaling pathway further connects NLRP3 inflammasome activity to downstream effects promoting inflammatory responses and influencing adaptive immunity.

NLRP3 and NEK7 are linked to autoinflammatory diseases and neurodegenerative disorders. One well-studied association is with Cryopyrin-associated periodic syndromes (CAPS) where mutations in NLRP3 lead to abnormal inflammasome activation causing chronic inflammation. Another connection is identified in Alzheimer’s disease where the pathologic activation of the NLRP3 inflammasome contributes to neuroinflammation. Proteins such as ASC and caspase-1 are also implicated in these conditions highlighting the potential of targeting the inflammasome for therapeutic strategies.

일반 정보

기능

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502, PubMed : 39173637). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502, PubMed : 39173637, PubMed : 40450990). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).

서열 유사성

Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.

Post-translational modifications

Phosphorylation at Ser-195 required for its activation.

제품 프로토콜

타겟 정보

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502, PubMed : 39173637). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502, PubMed : 39173637, PubMed : 40450990). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).
See full target information NEK7

Additional targets

NLRP3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com