JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112298

Recombinant Human NMDAR2B protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NMDAR2B protein (GST tag N-Terminus) is a Human Fragment protein, in the 127 to 236 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

NMDAR2B, GRIN2B, GluN2B, Glutamate [NMDA] receptor subunit epsilon-2, N-methyl D-aspartate receptor subtype 2B, N-methyl-D-aspartate receptor subunit 3, NR2B, NR3, hNR3

1 이미지
SDS-PAGE - Recombinant Human NMDAR2B protein (GST tag N-Terminus) (AB112298)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NMDAR2B protein (GST tag N-Terminus) (AB112298)

ab112298 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

useful for Antibody Production and Protein Array

서열 정보

[{"linker":null,"sequence":"HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":236,"aminoAcidStart":127,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13224","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

NMDAR2B also known as NR2B or GluN2B functions as a subunit of the NMDA receptor complex. It plays a role in synaptic transmission and plasticity in the central nervous system. The target weighs approximately 166 kDa. It is highly expressed in the cerebral cortex hippocampus and striatum. NMDAR2B interacts with other subunits in the NMDA receptor which assemble to form a functional ion channel that allows for calcium ion influx when activated by glutamate and glycine.
Biological function summary

The NMDAR2B subunit contributes to the regulation of synaptic strength and is essential for processes involved in learning and memory. As part of the NMDA receptor complex it mediates excitatory neurotransmission and is involved in synaptic plasticity processes such as long-term potentiation (LTP). These functions are significant for cognitive function and neural development. The receptor's role in signal transduction is aided by the unique properties conferred by the NMDAR2B subunit such as its high affinity for glycine and slower deactivation kinetics.

Pathways

NMDAR2B is involved in the glutamatergic signaling pathway which is important for neural communication. It also participates in the calcium signaling pathway affecting cellular responses to external stimuli. The protein interacts with CaMKII and PSD-95 which are proteins that influence synaptic strength and architecture through these pathways. Its involvement links it to a variety of signaling events important for brain function.

Alterations in NMDAR2B have been associated with neurodegenerative conditions such as Alzheimer's disease and neurodevelopmental disorders like schizophrenia. The protein's malfunction can lead to abnormal synaptic connectivity and excitotoxicity. It is linked to other proteins associated with these diseases such as beta-amyloid in Alzheimer's and dopamine receptor dysregulation in schizophrenia indicating its role in disease progression and symptom manifestation.

일반 정보

기능

Component of N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with high calcium permeability and voltage-dependent block by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). Participates in synaptic plasticity for learning and memory formation by contributing to the long-term depression (LTD) of hippocampus membrane currents (By similarity). Channel activation requires binding of the neurotransmitter L-glutamate to the GluN2 subunit, glycine or D-serine binding to the GluN1 subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). NMDARs mediate simultaneously the potassium efflux and the influx of calcium and sodium (By similarity). Each GluN2 subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, Ca2(+) permeability, and binding to allosteric modulators (PubMed : 26875626, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death (By similarity).

서열 유사성

Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.

Post-translational modifications

Phosphorylated on tyrosine residues (By similarity). Phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity (By similarity).

Subcellular localisation

Late endosome

제품 프로토콜

타겟 정보

Component of N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with high calcium permeability and voltage-dependent block by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). Participates in synaptic plasticity for learning and memory formation by contributing to the long-term depression (LTD) of hippocampus membrane currents (By similarity). Channel activation requires binding of the neurotransmitter L-glutamate to the GluN2 subunit, glycine or D-serine binding to the GluN1 subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). NMDARs mediate simultaneously the potassium efflux and the influx of calcium and sodium (By similarity). Each GluN2 subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, Ca2(+) permeability, and binding to allosteric modulators (PubMed : 26875626, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death (By similarity).
See full target information GRIN2B

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com