JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB107133

Recombinant Human NME4 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NME4 protein (His tag N-Terminus) is a Human Full Length protein, in the 33 to 187 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

NM23D, NME4, NDPK-D, Nucleoside diphosphate kinase 4, nm23-H4, NDK4

1 이미지
SDS-PAGE - Recombinant Human NME4 protein (His tag N-Terminus) (AB107133)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NME4 protein (His tag N-Terminus) (AB107133)

15% SDS-PAGE showing ab107133 (3μg).

주요 정보

Purity

>90% SDS-PAGE

ab107133 is purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA","proteinLength":"Full Length","predictedMolecularWeight":"19.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":187,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00746","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

NME4 also known as nucleoside diphosphate kinase D is a mitochondrial protein with a mass of approximately 17 kDa. It is found in the inner mitochondrial membrane and is part of the NDP (nucleoside diphosphate) kinase family. This protein plays a role in transferring gamma-phosphates from nucleoside triphosphates to nucleoside diphosphates facilitating essential cellular energy transactions. NME4's catalytic activity helps maintain the balance and availability of nucleotides within the mitochondria.
Biological function summary

Nucleoside diphosphate kinase activity of NME4 contributes to energy homeostasis in cells. It assists in the generation of nucleoside triphosphates necessary for mitochondrial function and integrity. NME4 operates as part of multimeric complexes within the mitochondria ensuring efficient energy metabolism. Its role extends to contributing to cellular signaling pathways by providing the necessary energy substrates for a variety of cellular responses and activities.

Pathways

Researchers have found that NME4 is involved in the regulation of the mitochondrial apoptotic pathway. It interacts with other proteins involved in apoptosis such as Bcl-2 family members by influencing the mitochondrial outer membrane permeability. Additionally NME4 participates in pathways related to oxidative phosphorylation working alongside other proteins like ATP synthase to optimize energy production and utilization. These interactions underpin its versatility in sustaining cellular energy requirements and influencing cell survival.

Dysfunction in NME4 activity has been linked to mitochondrial diseases and cancer. In particular alterations in NME4 have implications in mitochondrial myopathy where energy production becomes compromised. Similarly cancer studies have shown changes in NME4 expression affect tumor growth and survival often in conjunction with proteins involved in metabolic regulation like p53. Understanding NME4's interactions and modifications can provide insights into its role in these diseases and potential therapeutic targets.

일반 정보

기능

Mitochondria-specific nucleoside diphosphate kinase that catalyzes the transfer of a gamma-phosphoryl group from ATP to a nucleoside diphosphate via a ping-pong mechanism involving a phosphohistidine intermediate, participating in nucleoside triphosphate homeostasis (PubMed : 10799505, PubMed : 16313181, PubMed : 18635542, PubMed : 23150663). In vitro, purine nucleoside triphosphates are much more effective as donors and acceptors than pyrimidine nucleoside triphosphates, and ribonucleosides derivatives are superior to their deoxyribonucleosides counterparts (By similarity). Associates with cardiolipin-containing mitochondrial inner membrane and locally produces ADP in the mitochondrial intermembrane space, which is directly taken up via the ADP/ATP translocase (ANT) into the matrix to stimulate respiratory ATP regeneration (PubMed : 18635542, PubMed : 24970086). Also directly provides GTP for mitochondrial GTPases, such as the dynamin-related GTPase OPA1 (PubMed : 24970086). Additionally, catalyzes the anionic phospholipid transfer, namely cardiolipin, from the mitochondrial inner membrane (IM) to the outer membrane (OM) through the formation of contact sites between IM and OM, in a nucleoside diphosphate kinase-independent manner (PubMed : 17028143, PubMed : 23150663). The switch between the nucleoside diphosphate kinase and the phospholipid transfer activity may depend on the availability and accessibility of cardiolipin and other anionic phospholipids in the IM outer leaflet and OM inner leaflet (PubMed : 23150663).

서열 유사성

Belongs to the NDK family.

Subcellular localisation

Mitochondrion intermembrane space

제품 프로토콜

타겟 정보

Mitochondria-specific nucleoside diphosphate kinase that catalyzes the transfer of a gamma-phosphoryl group from ATP to a nucleoside diphosphate via a ping-pong mechanism involving a phosphohistidine intermediate, participating in nucleoside triphosphate homeostasis (PubMed : 10799505, PubMed : 16313181, PubMed : 18635542, PubMed : 23150663). In vitro, purine nucleoside triphosphates are much more effective as donors and acceptors than pyrimidine nucleoside triphosphates, and ribonucleosides derivatives are superior to their deoxyribonucleosides counterparts (By similarity). Associates with cardiolipin-containing mitochondrial inner membrane and locally produces ADP in the mitochondrial intermembrane space, which is directly taken up via the ADP/ATP translocase (ANT) into the matrix to stimulate respiratory ATP regeneration (PubMed : 18635542, PubMed : 24970086). Also directly provides GTP for mitochondrial GTPases, such as the dynamin-related GTPase OPA1 (PubMed : 24970086). Additionally, catalyzes the anionic phospholipid transfer, namely cardiolipin, from the mitochondrial inner membrane (IM) to the outer membrane (OM) through the formation of contact sites between IM and OM, in a nucleoside diphosphate kinase-independent manner (PubMed : 17028143, PubMed : 23150663). The switch between the nucleoside diphosphate kinase and the phospholipid transfer activity may depend on the availability and accessibility of cardiolipin and other anionic phospholipids in the IM outer leaflet and OM inner leaflet (PubMed : 23150663).
See full target information NME4

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com