JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114183

Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) is a Human protein, in the 120 to 171 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

NOX2, CYBB, NADPH oxidase 2, CGD91-phox, Cytochrome b(558) subunit beta, Cytochrome b-245 heavy chain, Heme-binding membrane glycoprotein gp91phox, Neutrophil cytochrome b 91 kDa polypeptide, Superoxide-generating NADPH oxidase heavy chain subunit, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, Cytochrome b558 subunit beta

1 이미지
SDS-PAGE - Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) (AB114183)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) (AB114183)

ab114183 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

서열 정보

[{"linker":null,"sequence":"LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV","proteinLength":null,"predictedMolecularWeight":"31.35 kDa","actualMolecularWeight":null,"aminoAcidEnd":171,"aminoAcidStart":120,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P04839","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

NOX2 also known as gp91phox or cybb is a membrane-bound protein that plays an important role in the production of reactive oxygen species (ROS). This protein functions as a catalytic component of the NADPH oxidase complex which is primarily found in phagocytes like neutrophils and macrophages. The NOX2 protein has a molecular weight of approximately 91 kDa. It is expressed prominently in the cell membranes of these immune cells where it participates in the body's defense mechanisms.
Biological function summary

NOX2 participates in the generation of superoxide by using NADPH as a substrate an essential function performed by the multi-subunit NADPH oxidase complex. This process helps in the formation of microbicidal ROS which neutrophils and macrophages require for killing pathogens. The gp91phox component NOX2's alternate name partners with p22phox and other cytosolic subunits like p47phox and p67phox to form the fully active enzyme complex. This emphasizes NOX2's role in the immune system's oxidative burst an important antimicrobial response.

Pathways

NOX2 is an integral part of the oxidative burst pathway important in host defense. Its activity connects with the MAPK signaling pathway which can be activated by the presence of ROS produced by NOX2. This pathway involves proteins such as ERK JNK and p38 MAPKs which are related through the signaling events that lead to diverse cellular responses including inflammation and stress responses.

NOX2 dysregulation is associated with chronic granulomatous disease (CGD) a condition characterized by a compromised ability of phagocytes to produce ROS leading to recurrent infections. Additionally NOX2 activity links with cardiovascular diseases where its overproduction of ROS can cause oxidative stress contributing to atherosclerosis. The functioning of p22phox another protein in the NADPH oxidase complex becomes particularly relevant in these contexts as it partners with NOX2 to generate the harmful superoxide in such diseases.

일반 정보

기능

Catalytic subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (PubMed : 15338276, PubMed : 36241643, PubMed : 36413210, PubMed : 38355798). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (Probable) (PubMed : 38355798). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (PubMed : 19028840, PubMed : 38355798). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity). NADPH oxidase complex assembly is impaired through interaction with NRROS (By similarity).

Post-translational modifications

Glycosylated.. Phosphorylated on Ser and Thr residues by PKC during neutrophils activation (PubMed:19028840). Phosphorylation enhances the NADPH oxidase activity and stimulates its interaction with RAC2, NCF2/p67-phox, and NCF1/p47-phox (PubMed:19028840).. Undergoes 'Lys-48'-linked polyubiquitination, likely by RNF145, triggering endoplasmic reticulum-associated degradation.

제품 프로토콜

타겟 정보

Catalytic subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (PubMed : 15338276, PubMed : 36241643, PubMed : 36413210, PubMed : 38355798). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (Probable) (PubMed : 38355798). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (PubMed : 19028840, PubMed : 38355798). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity). NADPH oxidase complex assembly is impaired through interaction with NRROS (By similarity).
See full target information CYBB

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com