JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152583

Recombinant Human OSBP1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human OSBP1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 324 to 407 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

OSBP1, OSBP, Oxysterol-binding protein 1

1 이미지
SDS-PAGE - Recombinant Human OSBP1 protein (GST tag N-Terminus) (AB152583)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human OSBP1 protein (GST tag N-Terminus) (AB152583)

12.5% SDS-PAGE analysis of ab152583 stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT","proteinLength":"Fragment","predictedMolecularWeight":"34.98 kDa","actualMolecularWeight":null,"aminoAcidEnd":407,"aminoAcidStart":324,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P22059","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Oxysterol-binding protein 1 (OSBP1) also known as OSBP is a protein with a molecular mass of approximately 97 kilodaltons. It functions as an intracellular lipid transporter that binds oxysterols which are oxygenated derivatives of cholesterol. OSBP1 is involved in lipid exchange between the endoplasmic reticulum (ER) and the Golgi apparatus. It is expressed in various tissues with high levels observed in the liver brain and adipose tissue. OSBP1 facilitates the transport of sterols and phosphatidylinositol 4-phosphate (PI4P) influencing lipid metabolism and membrane formation.
Biological function summary

OSBP1 plays a significant role in maintaining cellular lipid homeostasis and is a part of the larger family of oxysterol-binding proteins. It participates in intracellular lipid transport and signaling aiding in the regulation of cholesterol metabolism. OSBP1 coordinates lipid exchange processes between the ER and other cellular compartments impacting membrane composition and function. Its activity is important for the generation of certain lipid domains contributing to cellular signaling pathways and membrane trafficking.

Pathways

OSBP1 interacts within complex lipid signaling networks and is critically involved in the regulation of the phosphoinositide and cholesterol pathways. It collaborates with proteins such as VAP-A at membrane contact sites to exchange lipids like cholesterol and PI4P. This interaction is key to maintaining lipid gradients essential for multiple cellular functions including signaling and vesicle trafficking. Additionally OSBP1 modulates the activity of downstream phosphatidylinositol 4-kinases affecting phosphoinositide metabolism.

OSBP1's dysregulation associates with abnormalities in lipid metabolism and related diseases. Such alterations can contribute to metabolic disorders like atherosclerosis due to its involvement in cholesterol transport and distribution. Furthermore OSBP1's function is linked to the pathogenesis of Niemann-Pick disease type C where cholesterol accumulation occurs. In these contexts OSBP1 operates in concert with other proteins such as Niemann-Pick C1 (NPC1) that participate in cholesterol trafficking and metabolism.

일반 정보

기능

Lipid transporter involved in lipid countertransport between the Golgi complex and membranes of the endoplasmic reticulum : specifically exchanges sterol (cholesterol) with phosphatidylinositol 4-phosphate (PI4P, 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate)), delivering sterol to the Golgi in exchange for PI4P, which is subsequently degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum (PubMed : 24209621, PubMed : 28978670). Binds cholesterol and a range of oxysterols including 25-hydroxycholesterol (PubMed : 15746430, PubMed : 17428193). Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylates ERK1/2, whereas 25-hydroxycholesterol causes its disassembly (PubMed : 15746430). Regulates cholesterol efflux by decreasing the stability of the relatively short lived ABCA1 protein (an important point of control for cholesterol efflux activity) (PubMed : 18450749).

서열 유사성

Belongs to the OSBP family.

제품 프로토콜

타겟 정보

Lipid transporter involved in lipid countertransport between the Golgi complex and membranes of the endoplasmic reticulum : specifically exchanges sterol (cholesterol) with phosphatidylinositol 4-phosphate (PI4P, 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate)), delivering sterol to the Golgi in exchange for PI4P, which is subsequently degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum (PubMed : 24209621, PubMed : 28978670). Binds cholesterol and a range of oxysterols including 25-hydroxycholesterol (PubMed : 15746430, PubMed : 17428193). Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylates ERK1/2, whereas 25-hydroxycholesterol causes its disassembly (PubMed : 15746430). Regulates cholesterol efflux by decreasing the stability of the relatively short lived ABCA1 protein (an important point of control for cholesterol efflux activity) (PubMed : 18450749).
See full target information OSBP

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com