JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152231

Recombinant Human Osteocalcin protein (GST tag N-Terminus)

4

(1 리뷰)

|

(1 출판물)

Recombinant Human Osteocalcin protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 100 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, BGP, BGLAP

1 이미지
SDS-PAGE - Recombinant Human Osteocalcin protein (GST tag N-Terminus) (AB152231)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Osteocalcin protein (GST tag N-Terminus) (AB152231)

12.5% SDS-PAGE analysis of ab152231 stained with Coomassie Blue.

주요 정보

Purity

>80%

Glutathione Sepharose

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV","proteinLength":"Full Length","predictedMolecularWeight":"37.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02818","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification GST Tag
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Osteocalcin also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP) is a small non-collagenous protein with a molecular weight of approximately 5.8 kDa. This protein is mainly expressed in osteoblasts which are bone-forming cells. It is an important component of the bone matrix and is involved in bone mineralization. Osteocalcin binds to calcium and incorporates into the hydroxyapatite crystals in the bone helping stabilize the bone structure. Researchers often study this protein as a marker for bone formation and turnover.
Biological function summary

Osteocalcin plays a significant role in regulating glucose metabolism and fat deposition. It acts as a hormone from the bone and influences energy metabolism and insulin sensitivity. Osteocalcin undergoes carboxylation a post-translational modification necessary for its function in bone. Beyond its structural role demineralized osteocalcin has been found to impact pancreatic β-cell function adipose tissue and male fertility although the pathways in these processes are not entirely understood yet.

Pathways

Osteocalcin is associated with the energy metabolism and bone remodeling pathways. It interacts with the insulin signaling pathway influencing insulin secretion by pancreatic β-cells and boosting insulin sensitivity. This interaction involves proteins like insulin receptor substrate 1 (IRS1) and glucose transporter type 4 (GLUT4) which play roles in glucose uptake. Osteocalcin also connects to bone remodeling pathways by influencing osteoclast differentiation and activity through osteoprotegrin and receptor activator of nuclear factor kappa-B ligand (RANKL).

Dysregulation of osteocalcin levels associates with metabolic syndrome and osteoporosis. It is linked with insulin resistance affecting glucose homeostasis and potentially contributing to diabetes development. Osteocalcin's involvement in bone density maintenance also makes it relevant in osteoporosis where bone formation balance is disrupted. The receptor activator of nuclear factor kappa-B ligand (RANKL) and osteoprotegrin which osteocalcin interacts with are other proteins connected to the pathogenesis of these conditions. Understanding osteocalcin's function helps in exploring therapeutic targets for these diseases.

일반 정보

기능

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein (PubMed : 3019668, PubMed : 6967872). Acts as a negative regulator of bone formation and is required to limit bone formation without impairing bone resorption or mineralization (By similarity). Binds strongly to apatite and calcium upon gamma-carboxylation; this modification is essential for bone metabolism (PubMed : 6967872, PubMed : 39880952).. The uncarboxylated form acts as a hormone secreted by osteoblasts, which regulates different cellular processes, such as energy metabolism, male fertility and brain development. Regulates of energy metabolism by acting as a hormone favoring pancreatic beta-cell proliferation, insulin secretion and sensitivity and energy expenditure. Uncarboxylated osteocalcin hormone also promotes testosterone production in the testes : acts as a ligand for G protein-coupled receptor GPRC6A at the surface of Leydig cells, initiating a signaling response that promotes the expression of enzymes required for testosterone synthesis in a CREB-dependent manner. Also acts as a regulator of brain development : osteocalcin hormone crosses the blood-brain barrier and acts as a ligand for GPR158 on neurons, initiating a signaling response that prevents neuronal apoptosis in the hippocampus, favors the synthesis of all monoamine neurotransmitters and inhibits that of gamma-aminobutyric acid (GABA). Osteocalcin also crosses the placenta during pregnancy and maternal osteocalcin is required for fetal brain development.

서열 유사성

Belongs to the osteocalcin/matrix Gla protein family.

Post-translational modifications

Carboxylated by vitamin K-dependent GGCX to form gamma-carboxyglutamate; these residues are essential for the binding of calcium (PubMed:6967872, PubMed:39880952). Decarboxylation promotes the hormone activity (By similarity).

제품 프로토콜

타겟 정보

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein (PubMed : 3019668, PubMed : 6967872). Acts as a negative regulator of bone formation and is required to limit bone formation without impairing bone resorption or mineralization (By similarity). Binds strongly to apatite and calcium upon gamma-carboxylation; this modification is essential for bone metabolism (PubMed : 6967872, PubMed : 39880952).. The uncarboxylated form acts as a hormone secreted by osteoblasts, which regulates different cellular processes, such as energy metabolism, male fertility and brain development. Regulates of energy metabolism by acting as a hormone favoring pancreatic beta-cell proliferation, insulin secretion and sensitivity and energy expenditure. Uncarboxylated osteocalcin hormone also promotes testosterone production in the testes : acts as a ligand for G protein-coupled receptor GPRC6A at the surface of Leydig cells, initiating a signaling response that promotes the expression of enzymes required for testosterone synthesis in a CREB-dependent manner. Also acts as a regulator of brain development : osteocalcin hormone crosses the blood-brain barrier and acts as a ligand for GPR158 on neurons, initiating a signaling response that prevents neuronal apoptosis in the hippocampus, favors the synthesis of all monoamine neurotransmitters and inhibits that of gamma-aminobutyric acid (GABA). Osteocalcin also crosses the placenta during pregnancy and maternal osteocalcin is required for fetal brain development.
See full target information BGLAP

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Scientific reports 7:16070 PubMed29167431

2017

Fabrication and Verification of Conjugated AuNP-Antibody Nanoprobe for Sensitivity Improvement in Electrochemical Biosensors.

Applications

Unspecified application

Species

Unspecified reactive species

Patricia Khashayar,Ghassem Amoabediny,Bagher Larijani,Morteza Hosseini,Jan Vanfleteren
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com