JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159042

Recombinant Human P2X7 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human P2X7 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 595 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

P2X purinoceptor 7, P2X7, ATP receptor, P2Z receptor, Purinergic receptor, P2RX7

1 Images
SDS-PAGE - Recombinant Human P2X7 protein (GST tag N-Terminus) (AB159042)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human P2X7 protein (GST tag N-Terminus) (AB159042)

ab159042 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q99572

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"sequence":"MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":595,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q99572","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The P2X7 receptor also known as P2RX7 is a ligand-gated ion channel primarily activated by ATP. It possesses a mass of approximately 68 kDa and is mainly expressed in immune cells like macrophages and microglia. P2X7 functions as a trimer forming a pore in the cell membrane that allows the passage of ions such as calcium (Ca²⁺) and sodium (Na⁺) influencing cell signaling and survival. This receptor is notable for its unique ability to change permeability to larger molecules upon prolonged stimulation with ATP.
Biological function summary

The P2X7 receptor influences immune response and inflammation. It plays a role in the release of pro-inflammatory cytokines like interleukin-1β (IL-1β) therefore participating in the regulation of inflammatory and immune responses. It forms a complex with other purinergic receptors affecting processes such as apoptosis and cell proliferation. The activation of P2X7 can lead to the formation of the inflammasome a component critical for cytokine processing and release.

Pathways

The P2X7 receptor integrates into the NOD-like receptor (NLR) signaling and the purinergic signaling pathways. It interacts with proteins from these pathways including NLRP3 and pannexin-1 which contribute to inflammasome assembly and function. P2X7 also impacts intracellular signaling cascades such as the PI3K/AKT pathway influencing cellular survival and immune responses.

Aberrant P2X7 receptor activity has connections to inflammatory and neurodegenerative conditions. In chronic inflammation the enhanced activity of this receptor can exacerbate diseases like rheumatoid arthritis by promoting excessive cytokine release. It is also associated with neurodegenerative disorders like Alzheimer's disease where P2X7 influences neuroinflammation and neuronal death interacting with proteins such as amyloid-beta.

일반 정보

기능

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed : 17483156, PubMed : 25281740, PubMed : 9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na(+) and Ca(2+), and the K(+) efflux (PubMed : 17483156, PubMed : 20453110, PubMed : 28235784, PubMed : 39262850). Also has the ability to form a large pore in the cell membrane, allowing the passage of large cationic molecules (PubMed : 17483156). In microglia, may mediate NADPH transport across the plasma membrane (PubMed : 39142135). In immune cells, P2RX7 acts as a molecular sensor in pathological inflammatory states by detecting and responding to high local concentrations of extracellar ATP. In microglial cells, P2RX7 activation leads to the release of pro-inflammatory cytokines, such as IL-1beta and IL-18, through the activation of the NLRP3 inflammasome and caspase-1 (PubMed : 26877061). Cooperates with KCNK6 to activate NLRP3 inflammasome (By similarity). Activates death pathways leading to apoptosis and autophagy (PubMed : 21821797, PubMed : 23303206, PubMed : 28326637). Activates death pathways leading to pyroptosis (By similarity).. Isoform B. Shows ion channel activity but no macropore function.. Isoform H. Non-functional channel.. Isoform J. Non-functional channel.

서열 유사성

Belongs to the P2X receptor family.

Post-translational modifications

Phosphorylation results in its inactivation.. ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.. Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface (PubMed:18971257). Palmitoylation prevents channel desensitization by physically anchoring the palmitoylated groups to the membrane (By similarity).

제품 프로토콜

타겟 정보

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed : 17483156, PubMed : 25281740, PubMed : 9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na(+) and Ca(2+), and the K(+) efflux (PubMed : 17483156, PubMed : 20453110, PubMed : 28235784, PubMed : 39262850). Also has the ability to form a large pore in the cell membrane, allowing the passage of large cationic molecules (PubMed : 17483156). In microglia, may mediate NADPH transport across the plasma membrane (PubMed : 39142135). In immune cells, P2RX7 acts as a molecular sensor in pathological inflammatory states by detecting and responding to high local concentrations of extracellar ATP. In microglial cells, P2RX7 activation leads to the release of pro-inflammatory cytokines, such as IL-1beta and IL-18, through the activation of the NLRP3 inflammasome and caspase-1 (PubMed : 26877061). Cooperates with KCNK6 to activate NLRP3 inflammasome (By similarity). Activates death pathways leading to apoptosis and autophagy (PubMed : 21821797, PubMed : 23303206, PubMed : 28326637). Activates death pathways leading to pyroptosis (By similarity).. Isoform B. Shows ion channel activity but no macropore function.. Isoform H. Non-functional channel.. Isoform J. Non-functional channel.
See full target information P2RX7

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com