JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134628

Recombinant Human p40-phox protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human p40-phox protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 339 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

SH3PXD4, NCF4, Neutrophil cytosol factor 4, NCF-4, Neutrophil NADPH oxidase factor 4, SH3 and PX domain-containing protein 4, p40-phox, p40phox

1 이미지
SDS-PAGE - Recombinant Human p40-phox protein (His tag N-Terminus) (AB134628)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human p40-phox protein (His tag N-Terminus) (AB134628)

15% SDS-PAGE analysis of ab134628 (3μg)

주요 정보

Purity

>90% SDS-PAGE

ab134628 was purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Previously labelled as NCF4.

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP","proteinLength":"Full Length","predictedMolecularWeight":"41.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":339,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15080","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

P40-phox also known as neutrophil cytosolic factor 4 (NCF4) is a regulatory component of the NADPH oxidase complex. It is expressed in phagocytic cells such as neutrophils and macrophages. The protein plays a role in the production of reactive oxygen species (ROS) during the respiratory burst. The molecular mass of p40-phox is approximately 40 kDa. It interacts with other subunits of the NADPH oxidase complex such as p67-phox and p47-phox contributing to the assembly and activation of the complex.
Biological function summary

P40-phox participates in innate immune responses by regulating the NADPH oxidase complex's function. It acts as a scaffold to facilitate the interaction between cytosolic and membrane components. p40-phox integrates into the cytosolic fraction with other subunits and translocates to the membrane upon stimulation. This translocation is essential for generating superoxide radicals that are involved in defense against pathogens. Its functional domains enable it to bind phosphatidylinositol (34) bisphosphate which anchors the protein to the membrane. p40-phox itself is not an enzyme but modulates the activity of the complex.

Pathways

The p40 protein serves as an important player in the signaling cascade of the respiratory burst. It interacts with the phosphoinositide 3-kinase (PI3K) pathway and cooperates with other proteins like p67-phox and p47-phox through phosphorylation-dependent mechanisms. The p40-phox is phox compatible meaning it can integrate into various signaling modules. Within the oxidative burst pathway it enhances the cytosolic complex's attachment to the membrane affecting the production of ROS.

Mutations in the p40-phox have been connected to chronic granulomatous disease (CGD) characterized by recurrent infections and granuloma formation. The lack of functional p40-phox disrupts the assembly of the NADPH oxidase complex leading to decreased ROS production. This deficiency impairs the ability of phagocytes to eliminate pathogens effectively. p40-phox is also related to inflammatory disorders like inflammatory bowel disease (IBD) as variations in the NCF4 gene affect the immune response. The dysfunction in ROS production impacts the signaling involving p67-phox and p47-phox further influencing disease pathogenesis.

일반 정보

기능

Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (Probable). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (By similarity). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (By similarity). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity).

Subcellular localisation

Endosome membrane

제품 프로토콜

타겟 정보

Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (Probable). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (By similarity). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (By similarity). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity).
See full target information NCF4

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com