JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB280943

Recombinant human PD-L1 protein (Active)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant human PD-L1 protein (Active) is a Human Fragment protein in the 19 to 238 aa range with >=95% purity, <= 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functional studies, ELISA, mass spectrometry and HPLC. The predicted molecular weight of ab2809432 protein is 25.3 kDa.

- Save time and ensure accurate results - use our PD-L1 protein as a control
- Optimal protein bioactivity, stability and reproducibility
- Available in different sizes to fit your experimental needs

대체 명칭 보기

CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1, Programmed cell death 1 ligand 1, PD-L1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1

5 이미지
Sandwich ELISA - Recombinant human PD-L1 protein (Active) (AB280943)
  • sELISA

Lab

Sandwich ELISA - Recombinant human PD-L1 protein (Active) (AB280943)

Sandwich ELISA - Recombinant human PD-L1 protein standard curve.

Background subtracted standard curve using Human/Monkey PD-L1 [28-8] Antibody Pair - BSA and Azide free (ab253485) and Recombinant human PD-L1 protein (Active) (ab280943) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

Functional Studies - Recombinant human PD-L1 protein (Active) (AB280943)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PD-L1 protein (Active) (AB280943)

Functional analysis of an280943.

Fully biologically active measured by its ability to inhibit anti-CD3 and anti-CD8 antibody induced T-cell expansion. ED50 for this effect is ≤500 ng/mL with a specific activity of 0.2 x 104 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3381126-2

Mass Spectrometry - Recombinant human PD-L1 protein (Active) (AB280943)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human PD-L1 protein (Active) (AB280943)

Mass determination by ESI-TOF.

Predicted MW is 25250.68 Da (+/- 10 Da by ESI-TOF). Observed MW is 25097.90 Da. M-100 due to loss of C-terminal arginine.

HPLC - Recombinant human PD-L1 protein (Active) (AB280943)
  • HPLC

Supplier Data

HPLC - Recombinant human PD-L1 protein (Active) (AB280943)

HPLC analysis of ab280943.

SDS-PAGE - Recombinant human PD-L1 protein (Active) (AB280943)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human PD-L1 protein (Active) (AB280943)

SDS-PAGE analysis of ab280943.

주요 정보

Purity

>95% SDS-PAGE

=95% by HPLC

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, Mass Spec, sELISA, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active measured by its ability to inhibit anti-CD3 and anti-CD8 antibody induced T-cell expansion. ED50 for this effect is ≤500 ng/mL with a specific activity of 0.2 x 104 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Ensure the validity of your result using our recombinant human PD-L1 protein ab280943 as a control.

The ab280943 PD-L1 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC. Analyze your PD-L1 ELISA data using the ab280943 protein to generate and plot a standard curve.

Check out our protein gel staining guide for SDS-PAGE here

Check out our ELISA protocol for more information here.

Premium Bioactive Protein range

The ab280943 PD-L1 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

서열 정보

[{"linker":null,"sequence":"FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER","proteinLength":"Fragment","predictedMolecularWeight":"25.25 kDa","actualMolecularWeight":"25.1 kDa","aminoAcidEnd":238,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NZQ7","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

PD-L1 also known as Programmed Death-Ligand 1 or CD274 is a protein involved in immune modulation. Mechanically PD-L1 interacts with its receptors particularly PD-1 to regulate cellular immune responses. This transmembrane protein has a calculated molecular weight of approximately 33 kDa. PD-L1 is expressed on various cell types including tumor cells and immune cells such as dendritic cells macrophages and B cells. Its expression is often upregulated in response to inflammatory cytokines.
Biological function summary

PD-L1 plays a central role in immune evasion mechanisms utilized by tumors. It is not part of a larger protein complex but directly interacts with PD-1 and CD80. When PD-L1 binds to PD-1 it sends inhibitory signals leading to decreased T cell activation and proliferation allowing cancer cells to avoid immune destruction. PD-L1 expression provides a mechanism for tumors to suppress immune surveillance facilitating tumor progression.

Pathways

PD-L1 is integral to the immune checkpoint pathway which is an important regulator of immune response. The interaction between PD-L1 and PD-1 provides a mechanism for immune tolerance which is part of the broader adaptive immune system pathway. PD-L1 is related to other immune checkpoint proteins such as CTLA-4 in its function to limit autoreactivity and promote immune homeostasis.

PD-L1 is most associated with cancer particularly in tumors such as melanoma and non-small cell lung cancer. PD-L1 expression on tumor cells often correlates with poor prognosis. PD-L1 directly interacts with PD-1 in these cancers a target for immunotherapies such as checkpoint inhibitors which aim to block this interaction and restore immune activity against tumors. PD-L1 involvement extends to autoimmune disorders where altered expression can impact tolerance and lead to immune-related tissue damage.

일반 정보

기능

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 36727298). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed : 10581077). Can also act as a transcription coactivator : in response to hypoxia, translocates into the nucleus via its interaction with phosphorylated STAT3 and promotes transcription of GSDMC, leading to pyroptosis (PubMed : 32929201).. The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 28813410, PubMed : 28813417). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).

서열 유사성

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Post-translational modifications

Ubiquitinated; STUB1 likely mediates polyubiquitination of PD-L1/CD274 triggering its degradation (PubMed:28813410). Ubiquitinated by MARCHF8; leading to degradation (PubMed:34183449). Deubiquitinated by USP22; leading to stabilization (PubMed:31399419).

제품 프로토콜

타겟 정보

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed : 11015443, PubMed : 28813410, PubMed : 28813417, PubMed : 36727298). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed : 10581077). Can also act as a transcription coactivator : in response to hypoxia, translocates into the nucleus via its interaction with phosphorylated STAT3 and promotes transcription of GSDMC, leading to pyroptosis (PubMed : 32929201).. The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed : 28813410, PubMed : 28813417). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).
See full target information CD274

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Translational oncology 52:102248 PubMed39709718

2024

Response Gene to Complement 32 is associated with poor patient survival and an inflamed tumor-immune microenvironment in clear cell renal cell carcinoma.

Applications

Unspecified application

Species

Unspecified reactive species

Lingling Li,Xiaocui Bu,Shuhui Wang,Yan Liu,Chongdao Chen,Wei Zhang,Peng Zhao
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com