JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259425

Recombinant human PDGF B protein (Active)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant human PDGF B protein (Active) is a Human Full Length protein, in the 82 to 190 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

대체 명칭 보기

PDGF2, SIS, PDGFB, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-Sis

4 이미지
Mass Spectrometry - Recombinant human PDGF B protein (Active) (AB259425)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human PDGF B protein (Active) (AB259425)

M + 0.41 Da (Calc. mass 12351.59 ).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human PDGF B protein (Active) (AB259425)
  • FuncS

Supplier Data

Functional Studies - Recombinant human PDGF B protein (Active) (AB259425)

Fully biologically active compared to a standard. The ED50 is is 0.9388 ng/mL corresponding to a Specific Activity of 1.07 x 106 IU/mg.

SDS-PAGE - Recombinant human PDGF B protein (Active) (AB259425)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human PDGF B protein (Active) (AB259425)

SDS-PAGE analysis of ab259425.

HPLC - Recombinant human PDGF B protein (Active) (AB259425)
  • HPLC

Supplier Data

HPLC - Recombinant human PDGF B protein (Active) (AB259425)

Purity 98%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

< 0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

Cell Culture, SDS-PAGE, Mass Spec, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active compared to a standard. The ED50 is is 0.9388 ng/mL corresponding to a Specific Activity of 1.07 x 106 IU/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

서열 정보

[{"linker":null,"sequence":"SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT","proteinLength":"Full Length","predictedMolecularWeight":"12.35 kDa","actualMolecularWeight":null,"aminoAcidEnd":190,"aminoAcidStart":82,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P01127","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

PDGF-B also known as platelet-derived growth factor subunit B or PDGF-BB is a critical protein involved in various cellular processes. Composed of 241 amino acids PDGF-B exhibits a molecular mass of approximately 27 kDa. Scientists recognize this protein for its expression primarily in platelets but it also appears in a range of other tissues including smooth muscle cells and fibroblasts. The PDGF-B protein plays a substantial role in the regulation of growth and division inducing pathways important for cellular proliferation.
Biological function summary

PDGF-B influences cellular signaling processes and facilitates interactions that are a part of the PDGF receptor system. PDGF-B can form a homo-dimerization commonly known as the PDGF-BB dimer which is an active form. When PDGF-B binds to its receptor specifically the PDGF receptor β (PDGFR-β) it triggers pathways that control various cellular activities including growth and survival. The interaction of PDGF-B with the receptor is an important step that modulates several downstream signaling pathways.

Pathways

PDGF-B activates significant pathways such as the MAPK/ERK and PI3K/AKT pathways. These pathways play a major role in the regulation of cell proliferation and differentiation. Through these pathways PDGF-B exhibits interactions with proteins like Ras and Akt which are integral in transmitting signals within the cell. These cascades result in the promotion of processes such as angiogenesis and wound healing highlighting the importance of PDGF-B in cellular function.

Researchers have linked PDGF-B to pathologies such as cancer and atherosclerosis. For instance overexpression of PDGF-B can lead to abnormal vascular growth contributing to tumor development in cancers. It also plays a role in the progression of atherosclerosis by promoting the migration and proliferation of smooth muscle cells leading to plaque formation. In these contexts PDGF-B shows interaction with other proteins such as VEGF in tumor angiogenesis and LDL in atherosclerotic developments reinforcing its involvement in these conditions.

일반 정보

기능

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed : 26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).

서열 유사성

Belongs to the PDGF/VEGF growth factor family.

제품 프로토콜

타겟 정보

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed : 26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).
See full target information PDGFB

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Arthritis research & therapy 25:194 PubMed37798786

2023

Preosteoclast plays a pathogenic role in syndesmophyte formation of ankylosing spondylitis through the secreted PDGFB - GRB2/ERK/RUNX2 pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Yulong Tang,Kai Yang,Qingmei Liu,Yanyun Ma,Hao Zhu,Kunhai Tang,Chengchun Geng,Jiangnan Xie,Dachun Zhuo,Wenyu Wu,Li Jin,Wenze Xiao,Jiucun Wang,Qi Zhu,Jing Liu
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com