JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236937

Recombinant Human Peroxiredoxin 2/PRP protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Peroxiredoxin 2/PRP protein (His tag) is a Human Full Length protein, in the 2 to 198 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

NKEFB, TDPX1, PRDX2, Peroxiredoxin-2, Natural killer cell-enhancing factor B, PRP, Thiol-specific antioxidant protein, Thioredoxin peroxidase 1, Thioredoxin-dependent peroxide reductase 1, Thioredoxin-dependent peroxiredoxin 2, NKEF-B, TSA

3 이미지
Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236937 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Peroxiredoxin 2/PRP.

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236937 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Peroxiredoxin 2/PRP.

SDS-PAGE - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Peroxiredoxin 2/PRP protein (His tag) (AB236937)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236937.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

6x His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN","proteinLength":"Full Length","predictedMolecularWeight":"22 kDa","actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P32119","tags":[{"tag":"6x His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Peroxiredoxin 2 (also known as PRP or PRDX2) is an antioxidant enzyme that plays an important role in reducing peroxides and protecting cells from oxidative damage. The target consisting of approximately 22kDa mass is expressed heavily in erythrocytes but can also be found in other tissues like the heart and liver. PRDX2 belongs to the peroxiredoxin family and its redox activity contributes significantly to cellular homeostasis and defense against oxidative stress.
Biological function summary

Peroxiredoxins like PRDX2 function by breaking down hydrogen peroxide and organic hydroperoxides safeguarding cells from oxidative harm. PRDX2 often forms homodimers or higher-order oligomers which influence its catalytic efficiency and chaperone activity. Within the cell it not only acts independently but also associates with other cellular components reflecting its participation in important cellular processes including cell proliferation and apoptosis.

Pathways

PRDX2 engages significantly within antioxidant defense systems specifically the thioredoxin pathway. It interacts with thioredoxin reductase and thioredoxin to facilitate the reduction of peroxides maintaining the cell’s redox balance. Furthermore PRDX2 intersects with cellular signaling pathways associated with inflammation and the regulation of cell death where proteins like NRF2 and KEAP1 play important roles in managing oxidant-inducible gene expression.

Disruptions in PRDX2 function connect to conditions like cancer and cardiovascular diseases. In cancer altered peroxiredoxin 2 expression correlates to tumor progression and resistance to chemotherapy implicating its interaction with proteins like NF-κB in enhancing cell survival. In cardiovascular diseases oxidative stress mediated by PRDX2 imbalance can lead to myocardial infarction and heart failure linking it to proteins such as SOD2 involved in mitochondrial defense.

일반 정보

기능

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

서열 유사성

Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.

Post-translational modifications

The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.. Acetylation increases resistance to transition to high molecular-mass complexes (PubMed:18606987). Deacetylated by HDAC6 which decreases reducing activity (PubMed:18606987).

제품 프로토콜

타겟 정보

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
See full target information PRDX2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com