JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112339

Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1192 to 1291 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

PLC1, PLCG1, PLC-148, Phosphoinositide phospholipase C-gamma-1, Phospholipase C-II, Phospholipase C-gamma-1, PLC-II, PLC-gamma-1

1 이미지
SDS-PAGE - Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (GST tag N-Terminus) (AB112339)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (GST tag N-Terminus) (AB112339)

ab112339 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as Phospholipase C gamma 1

서열 정보

[{"linker":null,"sequence":"LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":1291,"aminoAcidStart":1192,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P19174","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Phospholipase C gamma 1 (PLC-gamma-1) also known as PLCG1 or PLC-gamma plays an important role in cellular signaling. This enzyme has a molecular mass of approximately 150 kDa. It is found in multiple cell types but is highly expressed in the brain and immune cells. PLC-gamma-1 is involved in the hydrolysis of phosphatidylinositol 45-bisphosphate (PIP2) to generate inositol 145-trisphosphate (IP3) and diacylglycerol (DAG) leading to downstream signaling events that control various cellular processes.
Biological function summary

PLC-gamma-1 is integral in signal transduction and is an important player in the immune response. The protein does not function as part of a large multi-protein complex but interacts transiently with other signaling molecules. It acts downstream of growth factor receptors and immunoreceptors by mediating calcium release and activation of protein kinase C influencing cell proliferation migration and differentiation. Its expression pattern suggests a critical role in the nervous and immune systems affecting learning memory and immune defense.

Pathways

PLC-gamma-1 is an important component in both the phospholipase C and PLC-gamma pathways. These pathways include important interactions with proteins such as the receptor tyrosine kinases and Src family kinases. In these pathways PLC-gamma-1 modulates signals that guide cellular responses to external stimuli affecting processes like growth signaling and T-cell receptor activation which is vital in adaptive immunity.

PLC-gamma-1 has significant connections to cancer and immune deficiencies. Abnormal PLC-gamma-1 activity is observed in certain cancers such as breast cancer where it influences tumor growth and metastasis. Its dysregulation in immune cells leads to disorders like autoimmune diseases by impacting proteins such as LAT and SLP-76 which are important in T-cell signaling. Understanding PLC-gamma-1’s regulatory mechanisms helps in developing targeted therapies for these conditions.

일반 정보

기능

Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, EGFR, FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Plays a role in actin reorganization and cell migration (PubMed : 17229814). Guanine nucleotide exchange factor that binds the GTPase DNM1 and catalyzes the dissociation of GDP, allowing a GTP molecule to bind in its place, therefore enhancing DNM1-dependent endocytosis (By similarity).

Post-translational modifications

Tyrosine phosphorylated in response to signaling via activated FLT3, KIT and PDGFRA (By similarity). Tyrosine phosphorylated by activated FGFR1, FGFR2, FGFR3 and FGFR4. Tyrosine phosphorylated by activated FLT1 and KDR. Tyrosine phosphorylated by activated PDGFRB. The receptor-mediated activation of PLCG1 involves its phosphorylation by tyrosine kinases, in response to ligation of a variety of growth factor receptors and immune system receptors. For instance, SYK phosphorylates and activates PLCG1 in response to ligation of the B-cell receptor. May be dephosphorylated by PTPRJ. Phosphorylated by ITK and TXK on Tyr-783 upon TCR activation in T-cells.. Ubiquitinated by CBLB in activated T-cells.

제품 프로토콜

타겟 정보

Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, EGFR, FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Plays a role in actin reorganization and cell migration (PubMed : 17229814). Guanine nucleotide exchange factor that binds the GTPase DNM1 and catalyzes the dissociation of GDP, allowing a GTP molecule to bind in its place, therefore enhancing DNM1-dependent endocytosis (By similarity).
See full target information PLCG1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com