JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159129

Recombinant Human PI 3 Kinase p110 delta protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human PI 3 Kinase p110 delta protein (GST tag N-Terminus) is a Human Fragment protein, in the 138 to 247 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

PI3-kinase subunit delta, PI3K-delta, PI3Kdelta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta, p110delta, PIK3CD

1 이미지
SDS-PAGE - Recombinant Human PI 3 Kinase p110 delta protein (GST tag N-Terminus) (AB159129)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PI 3 Kinase p110 delta protein (GST tag N-Terminus) (AB159129)

ab159129 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":247,"aminoAcidStart":138,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O00329","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Phosphoinositide 3-kinase p110 delta also known as PI3Kδ or PIK3CD is a catalytic subunit of the class I PI3K enzyme complex. It plays a significant role in the phosphorylation of the 3'-hydroxyl group of inositol lipids which acts as a signal transducer. The molecular weight of p110 delta is approximately 110 kDa. This protein is highly expressed in leukocytes especially in B and T lymphocytes. Expression can also be seen in other cell types like neutrophils.
Biological function summary

P110 delta is involved in immune cell signaling as it is part of the class I PI3K complex. PI3Kδ functions in conjunction with p85 regulatory subunits to modulate various intracellular processes. The complex plays an important role in regulating cell growth proliferation and survival by mediating signals from growth factors or cytokines. It is also critical in the development and function of the adaptive immune system.

Pathways

PI3Kδ participates in the PI3K/AKT signaling pathway an important regulatory pathway in cell growth and survival. Another significant pathway involving p110 delta is the B-cell receptor (BCR) signaling pathway which is important for B cell development. Within these pathways PI3Kδ interacts with proteins such as AKT mTOR and BCR-related proteins that propagate downstream signaling events.

Aberrant activity of PI3Kδ has been linked to various immune-related diseases such as chronic lymphocytic leukemia (CLL) and rheumatoid arthritis. The overactivation of PI3Kδ in CLL correlates with enhanced survival and proliferation of malignant B cells. Additionally PI3Kδ dysfunction can influence inflammation pathways contributing to autoimmune conditions. The protein often works in concert with other proteins in these disease contexts such as B cells in CLL where it affects signaling via the B-cell receptor pathway.

일반 정보

기능

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 9235916). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Plays a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Plays important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function. Isoform 2 may be involved in stabilizing total RAS levels, resulting in increased ERK phosphorylation and increased PI3K activity.

서열 유사성

Belongs to the PI3/PI4-kinase family.

Post-translational modifications

Autophosphorylation on Ser-1039 results in the almost complete inactivation of the lipid kinase activity.

제품 프로토콜

타겟 정보

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed : 9235916). Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3) (PubMed : 15135396). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Plays a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Plays important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function. Isoform 2 may be involved in stabilizing total RAS levels, resulting in increased ERK phosphorylation and increased PI3K activity.
See full target information PIK3CD

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com