JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB153798

Recombinant Human PR3 protein

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human PR3 protein is a Human Full Length protein in the 26 to 249 aa range with >95% purity, < 1 EU/µg endotoxin level and suitable for SDS-PAGE and HPLC. The predicted molecular weight of ab153798 protein is 25.6 kDa.

- Save time and ensure accurate results - use our recombinant Human proteinase 3 (PR3) protein as a control

대체 명칭 보기

MBN, PRTN3, Myeloblastin, AGP7, C-ANCA antigen, Leukocyte proteinase 3, Neutrophil proteinase 4, P29, Wegener autoantigen, PR-3, PR3, NP-4

1 이미지
SDS-PAGE - Recombinant Human PR3 protein (AB153798)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human PR3 protein (AB153798)

SDS-PAGE analysis using ab153798.
Predicted MW 26 kDa with tag.

주요 정보

Purity

>95% SDS-PAGE

Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 μM filtered solution.

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

His tag C-Terminus

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.16% Tris HCl

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Ensure the validity of your result using our recombinant human proteinase 3 (PR3)/Myeloblastin protein ab153798 as a control in SDS-PAGE.


Check out our protein gel staining guide for SDS-PAGE here

서열 정보

[{"linker":null,"sequence":"AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"25.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":249,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P24158","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Proteinase 3 (PR3) also known as PRTN3 is a serine protease with a mass of approximately 29 kDa. It belongs to the human neutrophil elastase (HNE) family and is mainly expressed in neutrophils. Within these immune cells PR3 localizes to azurophilic granules where it participates in early immune responses. The proteolytic activity of PR3 involves cleaving peptide bonds in target proteins contributing to the processing and degradation of various proteins important for immune function.
Biological function summary

Proteinase 3 serves multiple roles including modulating inflammation and immune responses. PR3 functions as part of a complex with azurophilic granules aiding in microbial defense mechanisms. In addition the protease regulates cytokine activation and deactivation which in turn influences cell signaling related to inflammation. Its enzymatic action ensures that PR3 can manage inflammatory processes by breaking down extracellular matrix components thereby allowing white blood cells to access infection sites.

Pathways

Proteinase 3 plays an important role within the serine protease and inflammatory pathways. It interacts with other proteins such as neutrophil elastase with which it shares a pathway to modulate immune responses. PR3 also partners with cathepsin G contributing to processes such as pathogen clearance and tissue remodeling providing a coordinated response during infection and injury. These interactions show PR3's involvement in regulating the balance between inflammation and tissue repair.

PR3 is notably associated with Wegener's granulomatosis also known as granulomatosis with polyangiitis. This autoimmune condition results in systemic vasculitis where anti-proteinase 3 antibodies notably characterize the disease. Additionally PR3 plays a part in chronic obstructive pulmonary disease (COPD) where its proteolytic activity contributes to tissue damage in the lungs. In both conditions PR3 interplays with related proteins like myeloperoxidase further demonstrating its importance in processes leading to these disorders.

일반 정보

기능

Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) (PubMed : 2033050, PubMed : 28240246, PubMed : 3198760). By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascular integrity during neutrophil transendothelial migration (PubMed : 23202369). Plays a role in neutrophil transendothelial migration, probably when associated with CD177 (PubMed : 22266279). Triggers inflammatory processes in neutrophils by interacting with ADGRG3 upstream of F2RL1/PAR2 activation (PubMed : 36302784).

서열 유사성

Belongs to the peptidase S1 family. Elastase subfamily.

제품 프로토콜

타겟 정보

Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) (PubMed : 2033050, PubMed : 28240246, PubMed : 3198760). By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascular integrity during neutrophil transendothelial migration (PubMed : 23202369). Plays a role in neutrophil transendothelial migration, probably when associated with CD177 (PubMed : 22266279). Triggers inflammatory processes in neutrophils by interacting with ADGRG3 upstream of F2RL1/PAR2 activation (PubMed : 36302784).
See full target information PRTN3

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

The FEBS journal 287:4068-4081 PubMed31995266

2020

Human proteinase 3 resistance to inhibition extends to alpha-2 macroglobulin.

Applications

Unspecified application

Species

Unspecified reactive species

Koffi N'Guessan,Renata Grzywa,Seda Seren,Guillaume Gabant,Maria A Juliano,Marc Moniatte,Alain van Dorsselaer,Joseph G Bieth,Christine Kellenberger,Francis Gauthier,Magdalena Wysocka,Adam Lesner,Marcin Sienczyk,Martine Cadene,Brice Korkmaz
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com