JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236335

Recombinant Human PU.1/Spi1 protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human PU.1/Spi1 protein (His tag) is a Human Full Length protein, in the 1 to 270 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Transcription factor PU.1, 31 kDa-transforming protein, SPI1

3 이미지
Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236335 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PU.1/Spi1.

SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human PU.1/Spi1 protein (His tag) (AB236335)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) ananlysis with 5% enrichment gel and 15% separation gel of ab236335.

주요 정보

Purity

>85% SDS-PAGE

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH","proteinLength":"Full Length","predictedMolecularWeight":"35.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":270,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P17947","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

PU.1 also known as Spi1 is a transcription factor that belongs to the ETS family of transcription factors. It plays a major role in gene regulation and is an important player in hematopoietic cell differentiation. PU.1 has a molecular mass of approximately 31 kDa and is predominantly expressed in hematopoietic cells such as myeloid and B-lymphoid cells. It actively interacts with specific DNA sequences to regulate the expression of target genes.
Biological function summary

PU.1 influences the development and function of various blood cells including macrophages neutrophils and B-cells. It is essential for the regulation of genes involved in immune responses cell proliferation and survival. PU.1 functions as part of a larger transcriptional regulatory complex and often partners with other transcription factors and coactivators to exert its effects. This cooperation allows precise gene expression control in specific cell lineages.

Pathways

Expression of PU.1 is critical in the hematopoietic development pathway and the immune response pathway. It closely interacts with other transcription factors like GATA-1 and C/EBPα forming a network that affects hematopoietic lineage commitment. Within these pathways PU.1 constantly coordinates signals that influence progenitor cell fate and differentiation ensuring a balanced proportion of cell types within the blood.

PU.1 has significant implications in leukemia and other hematological malignancies. Dysregulation or mutation of PU.1 can lead to improper hematopoietic cell development and contribute to acute myeloid leukemia (AML) and other blood disorders. Additionally its expression level is closely linked with immune system function associating PU.1 indirectly with autoimmune conditions. In these contexts the interaction with other proteins like AML1 and C/EBPγ can influence disease pathogenesis by modulating gene expression patterns critical for normal hematopoietic and immune function.

일반 정보

기능

Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control gene expression by binding genetic regulatory elements and can also more broadly influence transcription by recruiting transcription factors, such as interferon regulatory factors (IRFs), to otherwise inaccessible genomic regions (PubMed : 23658224, PubMed : 33951726). Transcriptionally activates genes important for myeloid and lymphoid lineages, such as CSF1R (By similarity). Transcriptional activation from certain promoters, possibly containing low affinity binding sites, is achieved cooperatively with other transcription factors. FCER1A transactivation is achieved in cooperation with GATA1 (By similarity). May be particularly important for the pro- to pre-B cell transition (PubMed : 33951726). Binds (via the ETS domain) onto the purine-rich DNA core sequence 5'-GAGGAA-3', also known as the PU-box (PubMed : 33951726). In vitro can bind RNA and interfere with pre-mRNA splicing (By similarity).

서열 유사성

Belongs to the ETS family.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control gene expression by binding genetic regulatory elements and can also more broadly influence transcription by recruiting transcription factors, such as interferon regulatory factors (IRFs), to otherwise inaccessible genomic regions (PubMed : 23658224, PubMed : 33951726). Transcriptionally activates genes important for myeloid and lymphoid lineages, such as CSF1R (By similarity). Transcriptional activation from certain promoters, possibly containing low affinity binding sites, is achieved cooperatively with other transcription factors. FCER1A transactivation is achieved in cooperation with GATA1 (By similarity). May be particularly important for the pro- to pre-B cell transition (PubMed : 33951726). Binds (via the ETS domain) onto the purine-rich DNA core sequence 5'-GAGGAA-3', also known as the PU-box (PubMed : 33951726). In vitro can bind RNA and interfere with pre-mRNA splicing (By similarity).
See full target information SPI1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com