JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB62956

Recombinant Human Rab5A protein (Tag Free)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Rab5A protein (Tag Free) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, WB.
3 이미지
Western blot - Recombinant Human Rab5A protein (Tag Free) (AB62956)
  • WB

Lab

Western blot - Recombinant Human Rab5A protein (Tag Free) (AB62956)

All lanes:

Western blot - Anti-Rab5 antibody [EPR17321] - Early Endosome Marker (<a href='/ko/products/primary-antibodies/rab5-antibody-epr17321-early-endosome-marker-ab199530'>ab199530</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Rab5A protein (Tag Free) (ab62956)

Lane 2:

Western blot - Recombinant Human Rab5b protein (His tag N-Terminus) (<a href='/ko/products/proteins-peptides/recombinant-human-rab5b-protein-ab104545'>ab104545</a>)

Lane 3:

Western blot - Recombinant Human RAB5C/RABL protein (His tag N-Terminus) (<a href='/ko/products/proteins-peptides/recombinant-human-rab5c-rabl-protein-ab156358'>ab156358</a>)

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/ko/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 24 kDa

Observed band size: 26 kDa

false

Western blot - Recombinant Human Rab5A protein (Tag Free) (AB62956)
  • WB

Unknown

Western blot - Recombinant Human Rab5A protein (Tag Free) (AB62956)

All lanes:

Western blot - Anti-Rab5 antibody - Early Endosome Marker (<a href='/ko/products/primary-antibodies/rab5-antibody-early-endosome-marker-ab18211'>ab18211</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human Rab5A protein (Tag Free) (ab62956) at 0.001 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/ko/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 24 kDa

true

Exposure time: 150s

SDS-PAGE - Recombinant Human Rab5A protein (Tag Free) (AB62956)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Rab5A protein (Tag Free) (AB62956)

SDS Page analysis of ab62956 (3 ug)

주요 정보

Purity

>95% SDS-PAGE

purified by using conventional chromatography techniques

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, WB

applications

Biologically active

No

Accession

P20339-1

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 6 Constituents: PBS, 0.242% Tris

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab62956 can be used as a WB positive control in conjunction with <a href='/ko/products/primary-antibodies/rab5-antibody-early-endosome-marker-ab18211'>ab18211</a>.</p>" } } }

서열 정보

[{"linker":null,"sequence":"MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20339","tags":[]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Rab5A also known as RAB5A or Ras-related protein Rab-5A is a small GTPase with a molecular weight of approximately 24 kDa. Rab5A plays a role in the regulation of endocytic trafficking. It switches between an active GTP-bound state and an inactive GDP-bound state which facilitates its function in vesicle fusion and transport. Rab5A is highly expressed in various tissues with significant expression in the brain liver and kidney indicating its important regulatory role in these organs.
Biological function summary

Rab5A influences the coordination of membrane trafficking and cytoskeletal dynamics. It associates with several protein complexes involved in endocytosis. Rab5A recruits effectors that facilitate the early stages of endosome formation and maturation. It regulates the homotypic fusion and motility of early endosomes by activating its downstream effectors such as EEA1 and Rabenosyn-5 which coordinate vesicle tethering and fusion.

Pathways

Rab5A is intricately involved in the endocytic pathway and the PI3K-Akt signaling pathway. This protein modulates the formation and maturation of endosomes playing a part in the cellular sorting and internalization of receptors. Rab5A interacts with proteins like early endosome antigen 1 (EEA1) in the endocytic pathway and also links to phosphatidylinositol-3-phosphate (PI3P) production which is critical for signaling associated with cellular growth and survival.

Rab5A is associated with neurodegenerative diseases such as Alzheimer's disease and cancer progression. Aberrant Rab5A activity leads to disrupted endocytic trafficking which results in the malfunction of cellular processes that contribute to Alzheimer's disease pathology. In cancer Rab5A interaction with proteins like epidermal growth factor receptor (EGFR) modulates signal transduction pathways that facilitate oncogenic transformation and tumor progression. Hence Rab5A represents a potential therapeutic target in these conditions.

일반 정보

기능

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed : 10818110, PubMed : 14617813, PubMed : 15378032, PubMed : 16410077). Contributes to the regulation of filopodia extension (PubMed : 14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed : 22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).

서열 유사성

Belongs to the small GTPase superfamily. Rab family.

Post-translational modifications

Phosphorylation of Ser-84 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including RAB GDP dissociation inhibitors GDI1 and GDI2.. (Microbial infection) Glycosylated on arginine residues by S.typhimurium protein Ssek3.

Subcellular localisation

Early endosome membrane

제품 프로토콜

타겟 정보

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed : 10818110, PubMed : 14617813, PubMed : 15378032, PubMed : 16410077). Contributes to the regulation of filopodia extension (PubMed : 14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed : 22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).
See full target information RAB5A

대체 명칭 보기

RAB5, RAB5A, Ras-related protein Rab-5A

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com