JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283473

Recombinant Human RAGE protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human RAGE protein is a Human Fragment protein, in the 23 to 342 aa range, expressed in HEK 293 cells, with >95%, suitable for SDS-PAGE.

대체 명칭 보기

RAGE, AGER, Advanced glycosylation end product-specific receptor, Receptor for advanced glycosylation end products

1 이미지
SDS-PAGE - Recombinant Human RAGE protein (AB283473)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human RAGE protein (AB283473)

SDS-PAGE analysis of ab283473.

주요 정보

Purity

>95% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA","proteinLength":"Fragment","predictedMolecularWeight":"34.04 kDa","actualMolecularWeight":null,"aminoAcidEnd":342,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15109","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

RAGE also known as Receptor for Advanced Glycation End-products is a multi-ligand cell surface receptor with a molecular weight of approximately 45 kDa. It belongs to the immunoglobulin superfamily consisting of three extracellular immunoglobulin-like domains a transmembrane domain and a cytoplasmic tail. RAGE is widely expressed in various tissues throughout the body with high expression levels in the lungs heart and cells of the nervous system. The receptor can interact with several ligands such as advanced glycation end-products (AGEs) amyloid beta and S100/calgranulin proteins facilitating signal transduction into the cells.
Biological function summary

RAGE functions in the immune and inflammatory response where it mediates cell signaling that leads to cellular activation and the release of pro-inflammatory cytokines. It acts as part of complexes with different proteins contributing to cellular processes such as proliferation and migration. RAGE also plays roles in the regulation of oxidative stress and apoptosis impacting cellular health and survival. Researchers employ tools like 'anti-RAGE' antibodies and 'RAGER ELISA' assays to measure and study RAGE expression levels and its interactions in various experimental setups.

Pathways

RAGE is significantly involved in the NF-kB pathway and the MAPK signaling cascade. Its activation can lead to the release of NF-kB a transcription factor that plays an essential role in immune and inflammatory responses. RAGE interacts with proteins such as p38 MAPK leading to a cascade of events that regulate inflammation and stress responses. The signaling pathways involving RAGE are important in maintaining cell homeostasis and responding to cellular stressors and tools like 'anti-RAGE' and 'mouse RAGE' antibodies serve to elucidate these complex pathways further.

RAGE has strong associations with chronic diseases like diabetes and Alzheimer's disease. In diabetes RAGE binds to AGEs contributing to inflammation and vascular complications where it often interacts with proteins like iNOS and VEGF. In Alzheimer's disease RAGE is implicated in the accumulation and toxicity of amyloid-beta peptides interacting with proteins such as APP and tau. Understanding RAGE's role in these diseases can aid in developing therapeutic strategies employing reagents such as 'phen RAGE' and 'anti-RAGE' for targeted treatment approaches.

일반 정보

기능

Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PubMed : 27572515, PubMed : 28515150, PubMed : 34743181). Advanced glycosylation end products are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes (PubMed : 21565706). These ligands accumulate at inflammatory sites during the pathogenesis of various diseases, including diabetes, vascular complications, neurodegenerative disorders, and cancers and RAGE transduces their binding into pro-inflammatory responses. Upon ligand binding, uses TIRAP and MYD88 as adapters to transduce the signal ultimately leading to the induction or inflammatory cytokines IL6, IL8 and TNFalpha through activation of NF-kappa-B (PubMed : 21829704, PubMed : 33436632). Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key pro-inflammatory mediators (PubMed : 19386136). Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons (PubMed : 19906677). ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Participates in endothelial albumin transcytosis together with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability (PubMed : 27572515). Mediates the loading of HMGB1 in extracellular vesicles (EVs) that shuttle HMGB1 to hepatocytes by transferrin-mediated endocytosis and subsequently promote hepatocyte pyroptosis by activating the NLRP3 inflammasome (PubMed : 34743181). Promotes also extracellular hypomethylated DNA (CpG DNA) uptake by cells via the endosomal route to activate inflammatory responses (PubMed : 24081950, PubMed : 28515150).

Post-translational modifications

Phosphorylated on its cytoplasmic domain by PKCzeta/PRKCZ upon ligand binding.. Targeted by the ubiquitin E3 ligase subunit FBXO10 to mediate its ubiquitination and degradation.

제품 프로토콜

타겟 정보

Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PubMed : 27572515, PubMed : 28515150, PubMed : 34743181). Advanced glycosylation end products are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes (PubMed : 21565706). These ligands accumulate at inflammatory sites during the pathogenesis of various diseases, including diabetes, vascular complications, neurodegenerative disorders, and cancers and RAGE transduces their binding into pro-inflammatory responses. Upon ligand binding, uses TIRAP and MYD88 as adapters to transduce the signal ultimately leading to the induction or inflammatory cytokines IL6, IL8 and TNFalpha through activation of NF-kappa-B (PubMed : 21829704, PubMed : 33436632). Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key pro-inflammatory mediators (PubMed : 19386136). Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons (PubMed : 19906677). ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Participates in endothelial albumin transcytosis together with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability (PubMed : 27572515). Mediates the loading of HMGB1 in extracellular vesicles (EVs) that shuttle HMGB1 to hepatocytes by transferrin-mediated endocytosis and subsequently promote hepatocyte pyroptosis by activating the NLRP3 inflammasome (PubMed : 34743181). Promotes also extracellular hypomethylated DNA (CpG DNA) uptake by cells via the endosomal route to activate inflammatory responses (PubMed : 24081950, PubMed : 28515150).
See full target information AGER

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com