JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132108

Recombinant Human RhoGDI protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human RhoGDI protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 204 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

GDIA1, ARHGDIA, Rho GDP-dissociation inhibitor 1, Rho GDI 1, Rho-GDI alpha

1 이미지
SDS-PAGE - Recombinant Human RhoGDI protein (GST tag N-Terminus) (AB132108)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RhoGDI protein (GST tag N-Terminus) (AB132108)

12.5% SDS-PAGE analysis of ab132108, stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD","proteinLength":"Full Length","predictedMolecularWeight":"48.18 kDa","actualMolecularWeight":null,"aminoAcidEnd":204,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P52565","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

RhoGDI also known as Rho GDP-dissociation inhibitor 1 is a regulatory protein with a mass of approximately 23 kDa. It primarily inhibits the dissociation of GDP from Rho GTPases such as RhoA Rac1 and Cdc42. This protein plays an important role in controlling the cycling between active GTP-bound and inactive GDP-bound states of small GTPases. RhoGDI shows expression in numerous tissues highlighting its widespread regulatory functions in cell signaling.
Biological function summary

RhoGDI modulates the activity of Rho family GTPases—a group responsible for organizing the actin cytoskeleton which determines cell shape polarity and movement. It does not operate alone; rather it is part of a complex with membrane-bound and cytosolic proteins offering a shuttle service to balance GTPases between cellular locations. By doing so RhoGDI influences processes like cell migration and the cell cycle integral to maintaining proper cellular architecture.

Pathways

Scientists recognize RhoGDI’s participation in key signaling pathways particularly the Rho GTPase cycle and actin cytoskeleton organization. It interacts with proteins like ROCK and PAK within these pathways to achieve precise control of cytoskeletal dynamics. RhoGDI coordinates with these proteins to play a central role in cellular responses to external stimuli impacting processes like wound healing and cellular development.

RhoGDI has associations with cancer and neurodegenerative diseases. Its deregulation can disrupt the Rho GTPase pathways leading to uncontrolled cell proliferation in cancers such as breast and prostate cancer. Additionally altered RhoGDI function affects neuronal growth and survival linking it to neurodegenerative conditions like Alzheimer’s disease. Within these contexts RhoGDI interacts with other proteins such as Rac1 and Cdc42 to influence disease progression and pathology.

일반 정보

기능

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.

서열 유사성

Belongs to the Rho GDI family.

제품 프로토콜

타겟 정보

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
See full target information ARHGDIA

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com