JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271734

Recombinant human RIP2 protein (Active) (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human RIP2 protein (Active) (GST tag N-Terminus) is a Human Fragment protein, in the 2 to 299 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

CARDIAK, RICK, RIP2, UNQ277/PRO314/PRO34092, RIPK2, Receptor-interacting serine/threonine-protein kinase 2, CARD-containing interleukin-1 beta-converting enzyme-associated kinase, RIP-like-interacting CLARP kinase, Receptor-interacting protein 2, Tyrosine-protein kinase RIPK2, CARD-containing IL-1 beta ICE-kinase, RIP-2

2 이미지
Functional Studies - Recombinant human RIP2 protein (Active) (GST tag N-Terminus) (AB271734)
  • FuncS

Supplier Data

Functional Studies - Recombinant human RIP2 protein (Active) (GST tag N-Terminus) (AB271734)

Specific activity of ab271734 was ≥15 pmol/min/μg.

SDS-PAGE - Recombinant human RIP2 protein (Active) (GST tag N-Terminus) (AB271734)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human RIP2 protein (Active) (GST tag N-Terminus) (AB271734)

SDS-PAGE analysis of ab271734.

주요 정보

Purity

>90% SDS-PAGE

Affinity purified.

발현 시스템

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: ≥15 pmol/min/μg.

Assay Conditions: Assay was done in a Kinase buffer using MBP (0.2 mg/ml) as a substrate with 20 μM ATP at 30°C for 45 minutes. The amount of ATP transferred was calculated using Kinase-Glo reagent.

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"NGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEE","proteinLength":"Fragment","predictedMolecularWeight":"61 kDa","actualMolecularWeight":null,"aminoAcidEnd":299,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"O43353","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

RIP2 also known as receptor-interacting serine/threonine-protein kinase 2 or RICK is a protein with roles in signal transduction. It functions mechanically as a kinase which means it adds a phosphate group to other proteins impacting their activity and stability. RIP2 weighs about 61 kDa and is mostly expressed in immune system-related tissues such as spleen thymus peripheral blood leukocytes and bone marrow. As a kinase RIP2 is an action part in the cellular response to external stimuli.
Biological function summary

RIP2 interacts with key components of the immune signaling network. It forms part of a complex with other proteins like nucleotide-binding oligomerization domain (NOD) proteins influencing immune responses. By binding to NOD1 and NOD2 RIP2 modulates inflammatory signaling pathways leading to the activation of NF-kB and the production of inflammatory cytokines. This protein helps regulate the body's defense against bacterial infections and influences inflammation processes.

Pathways

RIP2 plays an integral role in the NOD-like receptor signaling pathway and is also involved in toll-like receptor signaling. In its pathways RIP2 interacts closely with proteins like IKK complexes and the Tak1 complex orchestrating signaling cascades leading to the activation of NF-kB and MAPK pathways. These pathways are essential for instigating the immune response and managing inflammatory signals highlighting how RIP2 acts as a pivotal mediator in these biological routes.

Mutations or dysregulation of RIP2 are linked to inflammatory diseases and immune disorders such as Crohn's disease and Blau syndrome. RIP2's involvement in these conditions often involves its interaction with NOD2 influencing the improper immune response seen in these diseases. Changing RIP2 activity presents a target for developing kinase inhibitors that might help to manage inflammation and immune system disorders by modulating its signaling activity.

일반 정보

기능

Serine/threonine/tyrosine-protein kinase that plays an essential role in modulation of innate and adaptive immune responses (PubMed : 14638696, PubMed : 17054981, PubMed : 21123652, PubMed : 28656966, PubMed : 9575181, PubMed : 9642260). Acts as a key effector of NOD1 and NOD2 signaling pathways : upon activation by bacterial peptidoglycans, NOD1 and NOD2 oligomerize and recruit RIPK2 via CARD-CARD domains, leading to the formation of RIPK2 filaments (PubMed : 17054981, PubMed : 17562858, PubMed : 21123652, PubMed : 22607974, PubMed : 28656966, PubMed : 29452636, PubMed : 30026309). Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3, as well as 'Met-1'-linked (linear) polyubiquitination by the LUBAC complex, becoming a scaffolding protein for downstream effectors (PubMed : 22607974, PubMed : 28545134, PubMed : 29452636, PubMed : 30026309, PubMed : 30279485, PubMed : 30478312). 'Met-1'-linked polyubiquitin chains attached to RIPK2 recruit IKBKG/NEMO, which undergoes 'Lys-63'-linked polyubiquitination in a RIPK2-dependent process (PubMed : 17562858, PubMed : 22607974, PubMed : 29452636, PubMed : 30026309). 'Lys-63'-linked polyubiquitin chains attached to RIPK2 serve as docking sites for TAB2 and TAB3 and mediate the recruitment of MAP3K7/TAK1 to IKBKG/NEMO, inducing subsequent activation of IKBKB/IKKB (PubMed : 18079694). In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis (PubMed : 18079694). The protein kinase activity is dispensable for the NOD1 and NOD2 signaling pathways (PubMed : 29452636, PubMed : 30026309). Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappa-B activation by NOD2 (PubMed : 21887730). Also involved in adaptive immunity : plays a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation (PubMed : 14638696). Plays a role in the inactivation of RHOA in response to NGFR signaling (PubMed : 26646181).

서열 유사성

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.

Post-translational modifications

Polyubiquitinated via both 'Lys-63'- and 'Met-1'-linked polyubiquitin following recruitment by NOD1 or NOD2, creating docking sites for downstream effectors, triggering activation of the NF-kappa-B and MAP kinases signaling (PubMed:22607974, PubMed:29452636, PubMed:30026309). 'Lys-63'-linked polyubiquitination by XIAP is essential for NOD2 signaling and promotes recruitment of the LUBAC complex (PubMed:22607974, PubMed:29452636, PubMed:30026309). Also polyubiquitinated with 'Lys-63'-linked chains by PELI3, BIRC2/c-IAP1 and BIRC3/c-IAP2 (PubMed:19464198, PubMed:21931591). Ubiquitinated on Lys-209 via 'Lys-63'-linked by ITCH (PubMed:18079694, PubMed:19592251). Undergoes 'Lys-63'-linked deubiquitination by MYSM1 to attenuate NOD2-mediated inflammation and tissue damage (By similarity). Polyubiquitinated with 'Lys-63'-linked chains in response to Shigella infection, promoting its SQSTM1/p62-dependent autophagic degradation (PubMed:36221902). Undergoes 'Met-1'-linked polyubiquitination; the head-to-tail linear polyubiquitination is mediated by the LUBAC complex in response to NOD2 stimulation 'Met-1'-linked polyubiquitination (PubMed:23806334). 'Lys-63'-linked polyubiquitination by XIAP is required for recruimtent of the LUBAC complex and subsequent (PubMed:22607974). Linear polyubiquitination is restricted by FAM105B/otulin, probably to limit NOD2-dependent pro-inflammatory signaling activation of NF-kappa-B (PubMed:23806334). Ubiquitination at Lys-503 by ZNRF4 via 'Lys-48'-linked polyubiquitination promotes RIPK2 degradation by the proteasome; ubiquitination by ZNRF4 takes place during both acute and NOD2 tolerance conditions (PubMed:28656966).. Autophosphorylated (PubMed:16824733, PubMed:21123652, PubMed:28545134, PubMed:29452636). Phosphorylated at Ser-176, either via autophosphorylation or by LRRK2, enhancing activity (PubMed:16824733, PubMed:27830463). Autophosphorylation at Tyr-474 is required for effective NOD2 signaling (PubMed:21123652). Autophosphorylation is however not essential for NOD2 signaling (PubMed:29452636). Phosphorylation at Tyr-381 by Src kinase CSK occurs in a ARHGEF2-dependent manner and is required for NOD2-dependent innate immune activation (PubMed:21887730).. Degraded via selective autophagy following interaction with IRGM (PubMed:36221902). IRGM promotes NOD1/NOD2-RIPK2 RIPosome recruitment to autophagosome membranes (PubMed:36221902). RIPK2 biquitinated via 'Lys-63'-linked chains is then recognized by SQSTM1/p62, leading to the SQSTM1/p62-dependent autophagic degradation of the NOD1/NOD2-RIPK2 RIPosome (PubMed:36221902).. (Microbial infection) Acetylation of Ser-174, Ser-176 and Ser-178 by Yersinia YopJ prevents phosphorylation and activation, thereby promoting cell death.

제품 프로토콜

타겟 정보

Serine/threonine/tyrosine-protein kinase that plays an essential role in modulation of innate and adaptive immune responses (PubMed : 14638696, PubMed : 17054981, PubMed : 21123652, PubMed : 28656966, PubMed : 9575181, PubMed : 9642260). Acts as a key effector of NOD1 and NOD2 signaling pathways : upon activation by bacterial peptidoglycans, NOD1 and NOD2 oligomerize and recruit RIPK2 via CARD-CARD domains, leading to the formation of RIPK2 filaments (PubMed : 17054981, PubMed : 17562858, PubMed : 21123652, PubMed : 22607974, PubMed : 28656966, PubMed : 29452636, PubMed : 30026309). Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3, as well as 'Met-1'-linked (linear) polyubiquitination by the LUBAC complex, becoming a scaffolding protein for downstream effectors (PubMed : 22607974, PubMed : 28545134, PubMed : 29452636, PubMed : 30026309, PubMed : 30279485, PubMed : 30478312). 'Met-1'-linked polyubiquitin chains attached to RIPK2 recruit IKBKG/NEMO, which undergoes 'Lys-63'-linked polyubiquitination in a RIPK2-dependent process (PubMed : 17562858, PubMed : 22607974, PubMed : 29452636, PubMed : 30026309). 'Lys-63'-linked polyubiquitin chains attached to RIPK2 serve as docking sites for TAB2 and TAB3 and mediate the recruitment of MAP3K7/TAK1 to IKBKG/NEMO, inducing subsequent activation of IKBKB/IKKB (PubMed : 18079694). In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis (PubMed : 18079694). The protein kinase activity is dispensable for the NOD1 and NOD2 signaling pathways (PubMed : 29452636, PubMed : 30026309). Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappa-B activation by NOD2 (PubMed : 21887730). Also involved in adaptive immunity : plays a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation (PubMed : 14638696). Plays a role in the inactivation of RHOA in response to NGFR signaling (PubMed : 26646181).
See full target information RIPK2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com