JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112259

Recombinant Human RUNX2 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human RUNX2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 311 to 450 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

AML3, CBFA1, OSF2, PEBP2A, RUNX2, Runt-related transcription factor 2, Acute myeloid leukemia 3 protein, Core-binding factor subunit alpha-1, Oncogene AML-3, Osteoblast-specific transcription factor 2, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3-3 enhancer factor 1 alpha A subunit, SL3/AKV core-binding factor alpha A subunit, CBF-alpha-1, OSF-2, PEA2-alpha A, PEBP2-alpha A

1 이미지
SDS-PAGE - Recombinant Human RUNX2 protein (GST tag N-Terminus) (AB112259)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RUNX2 protein (GST tag N-Terminus) (AB112259)

Coomassie blue stained 12.5% SDS page analysis of ab112259

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"TSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS","proteinLength":"Fragment","predictedMolecularWeight":"41.03 kDa","actualMolecularWeight":null,"aminoAcidEnd":450,"aminoAcidStart":311,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13950","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

RUNX2 also known as core-binding factor subunit alpha-1 (CBFA1) is a transcription factor with a molecular weight of approximately 56 kDa. It plays a pivotal role in regulating osteoblast differentiation and skeletal morphogenesis. This protein resides mainly in the nucleus and shows a high expression in bone tissue. RUNX2 binds to DNA sequences to control transcription of genes essential for bone development and maturation. The protein also possesses a Runt-homology domain enabling it to attach to specific DNA sequences.
Biological function summary

This protein orchestrates bone formation by influencing the expression of genes involved in osteoblast differentiation. RUNX2 operates as part of the larger transcriptional complex that includes other proteins that modulate its activity. It maintains bone homeostasis by regulating the expression of osteogenic markers including bone sialoprotein and osteocalcin. The ability of RUNX2 to drive osteoblast lineage commitment highlights its importance in skeletal health and development.

Pathways

RUNX2 shows significant involvement in both the Wnt signaling and TGF-beta signaling pathways. Within the Wnt signaling pathway RUNX2 interacts with beta-catenin to facilitate osteoblastogenesis and support bone matrix deposition. In the TGF-beta signaling pathway RUNX2 modulates Smad-dependent transcriptional activity important for extracellular matrix production and bone remodeling. These interactions illustrate RUNX2's central role in mediating bone development and maintenance.

RUNX2 mutations and dysregulation link to cleidocranial dysplasia a condition characterized by delayed closure of sutures in the skull and other skeletal anomalies. Additionally RUNX2 is related to osteosarcoma a type of bone cancer where its abnormal expression often contributes to tumor progression. In these contexts RUNX2 interacts with proteins like p53 an important regulator of cell cycle highlighting its influence on tumor suppressor networks and osteogenic pathways.

일반 정보

기능

Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis (PubMed : 28505335, PubMed : 28703881, PubMed : 28738062). Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation : synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation.

Post-translational modifications

Phosphorylated; probably by MAP kinases (MAPK). Phosphorylation by HIPK3 is required for the SPEN/MINT and FGF2 transactivation during osteoblastic differentiation (By similarity). Phosphorylation at Ser-451 by CDK1 promotes endothelial cell proliferation required for tumor angiogenesis probably by facilitating cell cycle progression. Isoform 3 is phosphorylated on Ser-340.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis (PubMed : 28505335, PubMed : 28703881, PubMed : 28738062). Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation : synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation.
See full target information RUNX2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com