JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB187429

Recombinant Human SDHAF1 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human SDHAF1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 115 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

LYRM8, SDHAF1, SDH assembly factor 1, LYR motif-containing protein 8

1 이미지
SDS-PAGE - Recombinant Human SDHAF1 protein (His tag N-Terminus) (AB187429)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SDHAF1 protein (His tag N-Terminus) (AB187429)

15% SDS-PAGE analysis of ab187429 (3 μg).

주요 정보

Purity

>85% SDS-PAGE

ab187429 was purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS, 30% Glycerol (glycerin, glycerine), 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGSQPDDGDSPRNPHDSTGAPETRPDGR","proteinLength":"Full Length","predictedMolecularWeight":"15.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":115,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"A6NFY7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

SDHAF1 also known as Succinate Dehydrogenase Complex Assembly Factor 1 plays an important role in the assembly and maturation of succinate dehydrogenase (SDH) which is part of Complex II in the mitochondrial respiratory chain. This protein with a molecular mass of approximately 13 kDa is found primarily in the mitochondria. Its expression is necessary for the proper function of SDH which catalyzes the oxidation of succinate to fumarate in the tricarboxylic acid (TCA) cycle and participates in the electron transport chain.
Biological function summary

The interaction between SDHAF1 and other mitochondrial proteins ensures the correct assembly of the SDH complex. SDHAF1 acts as a chaperone in this process making sure that the flavoprotein subunit of SDH acquires its FAD cofactor. This assembly process is essential for maintaining cellular energy metabolism. By ensuring proper SDH complex formation SDHAF1 contributes to efficient energy production and cellular respiration.

Pathways

SDHAF1's role affects both the TCA cycle and the mitochondrial electron transport chain. The protein supports the efficient execution of these two significant pathways. Through its regulation of SDH activity SDHAF1 impacts the pathway's ability to produce ATP from the reduction of electron carriers. It interacts closely with other mitochondrial proteins involved in these pathways including SDHA SDHB SDHC and SDHD the structural subunits of SDH complex ensuring cohesive function of this energy-producing sequence.

Defective function or mutations in SDHAF1 can lead to metabolic disorders such as Leigh syndrome which is a severe neurological disorder. Mutations might impair the formation of the SDH complex disrupting the mitochondrial energy production process. Alongside SDH subunits SDHAF1 dysfunction may also contribute to disorders linked to complex II deficiencies and associated with mitochondrial myopathies. Understanding the role of SDHAF1 offers significant insight into the pathogenesis and potential treatments of these mitochondrial-related conditions.

일반 정보

기능

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol (PubMed : 19465911, PubMed : 24954417). Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants (PubMed : 24954417). May act together with SDHAF3 (PubMed : 24954417). Contributes to iron-sulfur cluster incorporation into SDHB by binding to SDHB and recruiting the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20 (PubMed : 26749241).

서열 유사성

Belongs to the complex I LYR family. SDHAF1 subfamily.

Subcellular localisation

Mitochondrion matrix

제품 프로토콜

타겟 정보

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol (PubMed : 19465911, PubMed : 24954417). Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants (PubMed : 24954417). May act together with SDHAF3 (PubMed : 24954417). Contributes to iron-sulfur cluster incorporation into SDHB by binding to SDHB and recruiting the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20 (PubMed : 26749241).
See full target information SDHAF1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com