JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161918

Recombinant Human SENP3 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human SENP3 protein (GST tag N-Terminus) is a Human Fragment protein, in the 301 to 400 aa range, expressed in Wheat germ, suitable for ELISA, WB.

대체 명칭 보기

SSP3, SUSP3, SENP3, Sentrin-specific protease 3, SUMO-1-specific protease 3, Sentrin/SUMO-specific protease SENP3

1 이미지
SDS-PAGE - Recombinant Human SENP3 protein (GST tag N-Terminus) (AB161918)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SENP3 protein (GST tag N-Terminus) (AB161918)

ab161918 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQN","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":400,"aminoAcidStart":301,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9H4L4","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

SENP3 also known as SUMO-specific protease 3 is a protein with a molecular mass of about 66 kDa. It functions primarily as a protease that reverses the SUMOylation of target proteins by cleaving SUMO residues which modulate protein functions and interactions. SENP3 localizes mostly in the nucleoplasm but can also be found in the cytoplasm. The expression of SENP3 varies across different tissues displaying higher levels in the liver heart and skeletal muscle indicating its role in these tissues’ functions.
Biological function summary

SENP3 modulates SUMOylated proteins' activity influencing cellular processes such as transcription signal transduction and stress response. It is part of a larger complex with nucleophosmin a nucleolar protein that assists SENP3 in stability and substrate localization. SENP3's regulation of SUMOylation is critical for maintaining cellular homeostasis and influencing the outcome of signaling pathways related to various stimuli.

Pathways

The activity of SENP3 affects the SUMOylation cycle an important cellular mechanism for post-translational modification. SENP3 plays a role in the DNA damage response pathway where it associates with proteins like NEMO modifying their activity to facilitate repair processes. Additionally SENP3 participates in the oxidative stress response pathway where its action on transcription factors helps cells adapt to stress conditions effectively.

SENP3 is linked to cancer and cardiovascular disease. In certain cancers including hepatocellular carcinoma SENP3 levels are often upregulated leading to altered transcriptional activity and promoting tumor growth. SENP3 also interacts with proteins such as MDM2 influencing p53 degradation and impacting cell cycle regulation. In cardiovascular disease SENP3 contributes to cardiac hypertrophy through its effects on hypertrophic signaling pathways making it a potential target for therapeutic intervention.

일반 정보

기능

Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates (PubMed : 16608850, PubMed : 32832608, PubMed : 36050397). Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability (PubMed : 15743823). Deconjugates SUMO2 and SUMO3 from CDCA8 (PubMed : 18946085). Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300 (PubMed : 19680224). Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1 (PubMed : 19015314). Plays a role in the regulation of sumoylation status of ZNF148 (PubMed : 18259216). Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed : 22872859). Deconjugates SUMO2 from KAT5 (PubMed : 32832608). Catalyzes desumoylation of MRE11 (PubMed : 36050397).

서열 유사성

Belongs to the peptidase C48 family.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates (PubMed : 16608850, PubMed : 32832608, PubMed : 36050397). Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability (PubMed : 15743823). Deconjugates SUMO2 and SUMO3 from CDCA8 (PubMed : 18946085). Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300 (PubMed : 19680224). Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1 (PubMed : 19015314). Plays a role in the regulation of sumoylation status of ZNF148 (PubMed : 18259216). Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed : 22872859). Deconjugates SUMO2 from KAT5 (PubMed : 32832608). Catalyzes desumoylation of MRE11 (PubMed : 36050397).
See full target information SENP3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com