JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB288810

Recombinant Human SHH protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human SHH protein (Active) is a Human Fragment protein, in the 24 to 197 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for FuncS.

대체 명칭 보기

Sonic hedgehog protein, SHH, HHG-1, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC

4 이미지
Functional Studies - Recombinant Human SHH protein (Active) (AB288810)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human SHH protein (Active) (AB288810)

Fully biologically active determined by its ability to induce alkaline phosphatase production by CCL-226 cells.

ED50 is >10 ug/ml, corresponding to a specific activity of 1 x 102 units/mg.

Mass Spectrometry - Recombinant Human SHH protein (Active) (AB288810)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human SHH protein (Active) (AB288810)

Mass determination by ESI-TOF.

Predicted MW is 19617 Da. (+/- 10 Da by ESI-TOF). Observed MW is 19618.04 Da.

SDS-PAGE - Recombinant Human SHH protein (Active) (AB288810)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SHH protein (Active) (AB288810)

SDS-PAGE analysis of ab288810

HPLC - Recombinant Human SHH protein (Active) (AB288810)
  • HPLC

Supplier Data

HPLC - Recombinant Human SHH protein (Active) (AB288810)

HPLC analysis of ab288810

주요 정보

Purity

>95% HPLC

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by its ability to induce alkaline phosphatase production by CCL-226 cells.

ED50 is >10 ug/ml, corresponding to a specific activity of 1 x 102 units/mg.

Accession

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG","proteinLength":"Fragment","predictedMolecularWeight":"19.62 kDa","actualMolecularWeight":"19.62 kDa","aminoAcidEnd":197,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15465","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
True

일반 정보

기능

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Once cleaved, ShhC is degraded in the endoplasmic reticulum (By similarity).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (By similarity). Essential for axon guidance (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PubMed : 10753901).

서열 유사성

Belongs to the hedgehog family.

Post-translational modifications

Sonic hedgehog protein. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (ShhN) (By similarity). Cholesterylation is required for the sonic hedgehog protein N-product targeting to lipid rafts and multimerization (PubMed:24522195, PubMed:26875496). ShhN is the active species in both local and long-range signaling, whereas the C-product (ShhC) is degraded in the endoplasmic reticulum (By similarity).. Sonic hedgehog protein N-product. N-palmitoylation by HHAT of ShhN is required for sonic hedgehog protein N-product multimerization and full activity (By similarity). It is a prerequisite for the membrane-proximal positioning and the subsequent shedding of this N-terminal peptide (PubMed:24522195).. Sonic hedgehog protein N-product. The lipidated N- and C-terminal peptides of ShhNp can be cleaved (shedding) (PubMed:24522195). The N-terminal palmitoylated peptide is cleaved at the Cardin-Weintraub (CW) motif site (PubMed:24522195). The cleavage reduced the interactions with heparan sulfate. The cleavage is enhanced by SCUBE2 (PubMed:23118222, PubMed:24522195).

제품 프로토콜

타겟 정보

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (By similarity). Both activities occur in the endoplasmic reticulum (By similarity). Once cleaved, ShhC is degraded in the endoplasmic reticulum (By similarity).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (By similarity). Essential for axon guidance (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PubMed : 10753901).
See full target information SHH

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com